(data stored in ACNUC30630 zone)

EMBL: CU458896.PE653

CU458896.PE653       Location/Qualifiers
FT   CDS_pept        660989..661936
FT                   /transl_table=11
FT                   /locus_tag="MAB_0658"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q267G7_MYCVN 3e-19"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60756"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHT4"
FT                   /protein_id="CAM60756.1"
FT                   /translation="MNPRSILVLVQRFFSEGPSRKVLRRRLVALSVLPALLLLGFAVKL
FT                   IVMVSTGYAAQSHYLAYDSYSLRDDVRILKSWNIIDSYKAYFTEGDRYVLEGRLAEAET
FT                   EFKESLKRVDPPESCPVRINLEVVLETRGDLKSADHKRDDAKKFWEEALAVTREAPAGC
FT                   FNTTSEPDEAVRKHLNETEQRLLDKLKDPPATSASPSPTTSPSPPPPEGGGGNGGDGQG
FT                   GGNGGDGQGGGNDHNDGQRGGDQNGQPNSLPGEPTQEGPSPGQPTQAPTPVGPDRIPTS
FT                   GANGANELHPDQGDPADVLKRSLENSTASGTDTE"
     gtgaacccgc ggtcgattct tgttttggtg caacggttct tcagcgaagg cccgagccgc        60
     aaggtgctgc ggcgcagact ggtggccctc tcggtgttgc ccgcattgtt gttgctcggg       120
     ttcgcggtga agctcattgt catggtgagc acggggtacg cggcgcagtc gcactatctc       180
     gcctacgact cgtactcgct gcgagatgac gtgcgaattc ttaagtcgtg gaacatcatc       240
     gactcgtaca aggcatactt cacggagggc gaccggtacg tactggaagg cagactcgcg       300
     gaagcggaaa ccgaattcaa ggagtcgctc aagcgggtgg atccgcccga gtcctgtccg       360
     gtgcggatca atctggaagt ggtattggaa acgcgcggcg acctcaagtc cgccgaccac       420
     aagcgggatg acgccaagaa gttttgggag gaagcgcttg ccgtcaccag ggaggcgccc       480
     gcaggctgct tcaacaccac cagcgaaccc gacgaagcgg ttcgtaagca cctcaacgag       540
     accgaacaac gactgctgga caagctaaaa gaccctcctg cgacgtcggc ctctcccagt       600
     cccacgacat cgccttcgcc gcctccgccg gaaggcggtg gtggtaacgg cggcgacggt       660
     caaggcggtg gtaacggcgg cgatggtcaa ggcggtggca atgaccacaa cgacggtcag       720
     cgcggcggtg atcagaatgg tcaacccaat tcattaccgg gcgagccgac ccaggagggc       780
     ccaagccctg ggcagcctac tcaggctccg accccggtcg ggccggaccg gattcctacc       840
     agcggcgcga acggtgcgaa cgagcttcac cccgaccagg gcgatccggc ggatgtgctc       900
     aagcgttccc tcgagaactc gacggcctcg ggtaccgata ccgaatag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page