(data stored in ACNUC30630 zone)

EMBL: CU458896.PE657

CU458896.PE657       Location/Qualifiers
FT   CDS_pept        665127..665342
FT                   /transl_table=11
FT                   /locus_tag="MAB_0662"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Y100_MYCTU 1e-17"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60760"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHT8"
FT                   /protein_id="CAM60760.1"
FT                   /translation="MCEVLYISEADLFEGDSTDLRELGLDSVRFVLLMKQLGVTRGSEL
FT                   QKRLVSDLSVAGWAQILEQGQPESAT"
     gtgtgcgagg tgctgtacat ctcggaagct gatctctttg aaggcgattc gaccgatctg        60
     cgggagctgg gcctggactc ggtccggttc gtgctgttga tgaagcagct cggcgtgacc       120
     cgtggctcgg agttgcagaa gcgtttggtt tccgaccttt ccgtcgcggg ttgggctcag       180
     atcctggaac agggacagcc ggagagcgcc acatga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page