(data stored in ACNUC30630 zone)

EMBL: CU458896.PE664

CU458896.PE664       Location/Qualifiers
FT   CDS_pept        671768..673174
FT                   /transl_table=11
FT                   /locus_tag="MAB_0669"
FT                   /product="Hypothetical PPE-family protein"
FT                   /note="Similar to PPE01_MYCTU 1e-72"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60767"
FT                   /db_xref="GOA:B1MHU5"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHU5"
FT                   /protein_id="CAM60767.1"
FT                   /translation="MTAPIWMAEPPEVHSALLSAGPGPGAVLAAAVQWQEIGNNYANTA
FT                   VELAQVLAGVRAGSWQGPSASEYVAAHLPYLAWLEQAAAESSVIAAQHETTAAAYNSAL
FT                   AAMPTLAELAANHITHGVLVGTNFFGINTIPIALNEADYVRMWVQAAATMSAYQATTEA
FT                   MTSAIPPTQQPPAILSPGGEARSDQSDVPGSPDQIMKMLQGFQQWFEKMGFNPATSAVL
FT                   AVIMLFLYDLLWYPYYASYLLPFLIPALSGLSGLAALMHLRPAAPGPVPAAALSPGDRP
FT                   IRRPTQHVEPNLAALPLPTSSVVPSGGSSVPVSTPTAPAHTVSSVPAPSAAISYAIPGL
FT                   VPPGVSFGPKSTEKSSESAVDTVAAVAAARGAVAAQARRRLRGKNKAEAGGRRHEYLEE
FT                   TAGMGATATADVPAYAATGRGTGPLGFAGTAPAAASTHVAATVRLSSDEARQVIPMLPS
FT                   TWDADGGDQN"
     gtgacggcac cgatatggat ggcagagcct ccggaggtgc attcggcgct gttgagcgcg        60
     ggacccgggc cgggtgcggt gctggccgct gccgtgcaat ggcaagagat cgggaacaac       120
     tacgccaaca cggcggtgga gctggctcag gtattggccg gggtgcgggc gggcagttgg       180
     caagggccca gcgcctcgga atacgtggcc gctcacctgc cctacttggc ctggctcgaa       240
     caggccgcgg cggagagcag tgtcattgcc gcacaacatg aaacaaccgc agcagcttat       300
     aacagcgccc tggcggccat gcccacgctc gcggagttgg ccgctaacca cattacgcac       360
     ggagtcctgg tcggcacgaa tttttttgga atcaacacca tccccatcgc gctcaacgaa       420
     gccgactacg ttcgtatgtg ggtgcaggcg gcggccacca tgagtgctta ccaagcgacc       480
     acggaggcca tgacgtcggc gataccgcca acccagcagc cgcccgcaat cctcagcccg       540
     ggcggtgagg cccgcagtga tcaatcggac gttccgggat caccggatca gatcatgaag       600
     atgctgcagg gctttcagca gtggttcgag aagatgggct tcaacccggc gacctcggca       660
     gtactggccg tgatcatgct gtttctctat gacctgttgt ggtacccgta ctacgcctcg       720
     tacctgttgc ccttcctgat ccccgctctt agcgggctga gcggcctggc cgcgctgatg       780
     cacctgcggc cggcggctcc cggaccggtg ccggcggccg cgctgtcccc gggagacagg       840
     ccgatacgcc ggccaaccca acacgtggag cccaatcttg ctgccctgcc gctgcccact       900
     tcctccgtgg ttccctcggg cggctcctcg gtgccggtat ccacaccgac cgcgcccgct       960
     cataccgtgt cttcggtccc ggctccatcc gcggccatca gctacgcgat accgggtttg      1020
     gtaccacccg gggtgagttt tggacccaag agcaccgaga agtcatccga gtcggccgtc      1080
     gacaccgtcg ctgccgtcgc ggcggcgaga ggggctgtgg cggcccaggc ccggcgcagg      1140
     ttgcgcggta agaacaaggc cgaggccggg ggcaggcgac acgagtacct ggaagagacg      1200
     gccggaatgg gggcgacggc cactgcagac gttccggcgt acgcggcgac cggccggggc      1260
     accggccccc tcggcttcgc gggcaccgcg ccggccgcag cgagtacaca cgtcgccgca      1320
     acggtcaggc tctcgtccga tgaggcccgg caggtgatac ccatgctgcc gagcacgtgg      1380
     gacgccgatg gcggcgacca gaattag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page