(data stored in ACNUC30630 zone)

EMBL: CU458896.PE678

CU458896.PE678       Location/Qualifiers
FT   CDS_pept        complement(686328..687134)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0684c"
FT                   /product="Hypothetical conserved protein"
FT                   /note="Similar to Q743H7_MYCPA e-102"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0684c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60781"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHV9"
FT                   /protein_id="CAM60781.1"
FT                   /translation="MRDLSRRSLLKLGAATGAGAALLGAGAFPAGADGAIAAGSFVSAA
FT                   RGGVRTEWRIARPPGVTGPIRPIIALHGKGQTAAGVMEGGVENMLAQAVAAGAKPFALA
FT                   SVDGGGGYWHKRASGEDSGAMVLNEFIPLLAEQGLDTSRVAFLGWSMGGYGAMLLGSRL
FT                   GAGRTAAITAVSPALWTSSGAAAPGAFDGAEDYAANSVWGLAALNSIPLRIDCGDSDPF
FT                   YSATKQFIAQLPTPPAGGFSPGGHDGAFWSSQIGAEMAWMAPLLTA"
     atgcgtgatc tgtcccgacg ctcactactc aagctgggtg cggccaccgg tgccggcgcc        60
     gcgttgctcg gagcaggggc cttccccgcc ggcgccgacg gcgccatcgc ggccggctcg       120
     tttgtttccg ccgcccgcgg cggagtccgc accgaatggc gtatcgcccg gccacccggg       180
     gtcaccgggc cgatccggcc catcatcgca ctgcacggta agggccaaac cgccgccggc       240
     gtcatggaag gcggcgtaga gaacatgctg gcgcaggcgg tggccgcggg cgccaagccg       300
     ttcgcgctcg cgagtgtcga cggtggcggt ggctattggc acaagcgggc gtcgggcgaa       360
     gattccggtg ccatggtgct caatgaattc atcccgctgt tggcagaaca gggtctggac       420
     acctcgcgtg tggcgttcct cggctggtcc atggggggat acggcgccat gctgctgggt       480
     tcacgcctgg gagcgggccg caccgccgcc atcaccgccg tcagtcctgc gctgtggacg       540
     tcctcgggcg cggcggcgcc gggcgccttc gacggtgccg aggactacgc cgccaactcg       600
     gtctggggat tggccgcgct gaactcgatc cccctgcgca tcgactgcgg cgacagcgat       660
     ccgttctaca gcgccaccaa gcagttcatt gctcagcttc cgacacctcc ggcaggcggg       720
     ttcagccccg gcggtcacga tggcgccttc tggagctcgc agatcggcgc ggaaatggcc       780
     tggatggcgc cgctgctcac cgcctag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page