(data stored in ACNUC30630 zone)

EMBL: CU458896.PE697

CU458896.PE697       Location/Qualifiers
FT   CDS_pept        complement(705350..706360)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0704c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0704c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60800"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHX8"
FT                   /protein_id="CAM60800.1"
FT                   /translation="MGMCGQWRRLRALALIGVSVLAGCDFTGAQSADRIDQALKPLPGV
FT                   SSVSHTVGRNGGFGPTEVSFDVYVRDEATTDQLSALTHVFTDQIHASRAFRTLRASLHV
FT                   RRWPPGNHMHSTMYVELRPSVTTPEPPWQDWLRLSRGDYGYEITGWATPADHDRSAGTS
FT                   LEITLFDGKNRRPGNIGAEEFAAVVRRLAADFPQSRSDWVITNSFIYANDPPSIRSAHG
FT                   LPTPAQLRLWQALDAIAPVHGAFNLDPLAFNPKQPDSNRIRLGKLAPRDMDRVAVKQLQ
FT                   LIAKSETATVYDIDEAQITVRPGRCSAGVQEPQPRTPDNVNMQAKLRAQFETCPR"
     atgggaatgt gtggtcagtg gagacggctc cgtgcgctgg cgctcatcgg ggtgtccgtg        60
     ctcgccggtt gcgacttcac cggtgcgcag tccgcggatc gaatcgacca ggccctcaag       120
     cctctgccgg gggtgtcgtc ggtgtcgcac accgtcgggc gcaatggcgg attcgggccc       180
     accgaggtca gcttcgacgt ctacgtacgc gacgaggcga ccaccgacca gctctccgcg       240
     ttgacacacg tcttcaccga tcaaatccac gcctcccgcg cgttccgcac gctcagggcc       300
     tccctccatg tgcggcgctg gcccccggga aatcacatgc attcgacgat gtatgtcgaa       360
     ctacggccgt cggtgaccac ccccgaaccg ccgtggcagg actggctgag gctgtcccgg       420
     ggcgactatg gatacgagat caccggttgg gcaacaccgg ccgaccatga ccggtccgcc       480
     gggaccagcc tcgagatcac cttgttcgat ggcaagaatc ggcgacccgg caacataggc       540
     gccgaggagt tcgcggcggt ggttcgccgg ctcgctgccg actttcccca gtcgagaagc       600
     gactgggtga tcaccaactc ctttatctac gccaatgatc cacccagcat ccgatccgcg       660
     cacggactgc cgaccccggc gcagttgcgc ctgtggcagg cactggatgc catcgcgccc       720
     gtccacggcg ccttcaatct ggacccgctc gccttcaatc ccaaacaacc cgacagcaat       780
     cgcatccggc tcggcaagct tgccccgcga gacatggatc gcgttgcggt caagcaactt       840
     caactgatcg cgaagtcgga aacggccacg gtttacgaca tcgacgaggc gcagatcacg       900
     gtgcgccccg ggcgctgctc ggcgggcgtg caagaaccgc aacccagaac gccggacaat       960
     gtgaatatgc aggccaagct gcgcgcccaa ttcgaaacct gcccgcgctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page