(data stored in ACNUC30630 zone)

EMBL: CU458896.PE705

CU458896.PE705       Location/Qualifiers
FT   CDS_pept        complement(713849..715165)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0712c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YXS4_NOCFA e-109"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0712c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60808"
FT                   /db_xref="GOA:B1MHY6"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHY6"
FT                   /protein_id="CAM60808.1"
FT                   /translation="MTQATATWRPSTRVAFRFCVVYFGLFCVLLTQIPFALLGVVGRVV
FT                   GGRFALTAMSLLNPLTSWVGSNLFGVNAVLHEDSGSGDQAAIWVLVFCILVLAIAASTV
FT                   WTVLDRRLSYPRLLAWFTLFLRLCLGGQMLFYGFAKLIPTQMPGPTLAQLLQPYGTLSP
FT                   ASVLWLQVGSSHPYEMALGAVEVIAGLLLFVPRTAVLGTMLSLASMAQVFLMNMTFDVP
FT                   VKLLSFHLLLISLVLLAPYLDRLLDFFVRQRASEPLSQPPLFNDHRRNRLAIWAQVMIG
FT                   LWVALGGVYDGWTTWHEYGGGGPKSELYGIWSVQAFFVDGTYVPPVATDRSRWQTIIFD
FT                   QPGAATYQRMNGELVVVSTEFDDGHLKLADISDNSGGKVGGKAPFADLTYSQPNVDSLL
FT                   LGGKLYGKPVTVMLKRMDPETFPLRSRGFHWVQEYPFFR"
     gtgacccagg ccaccgcgac atggcgcccg tcgacccgcg tcgcattccg gttctgcgtc        60
     gtctacttcg gcctgttctg cgtgctcctg acgcagatcc ccttcgcgct gctgggggtg       120
     gtgggccggg tggtcggcgg ccggttcgcg ctgacggcga tgtcgctact caatcctctt       180
     accagctggg tgggcagcaa cctgttcggc gtgaatgcgg tcctgcacga ggactccgga       240
     agcggcgatc aggccgcgat ctgggtcctg gtgttctgca tcctggtctt agcgatcgcg       300
     gcgagcacgg tatggacggt gctcgatcgc cgcctctcct atccgcggct gctcgcgtgg       360
     ttcaccctct tcctccggct gtgcctgggc ggacagatgc tcttctacgg gttcgccaag       420
     ctcatcccca ctcaaatgcc cggccccacg ctggctcagc tgctacagcc atacggcacg       480
     ctgagccctg cttctgtgct gtggttacag gtaggcagtt ctcaccctta cgagatggcg       540
     ctgggtgcgg tggaggtgat cgccgggctg ctgctgttcg tgccgcggac ggcggtgttg       600
     ggcaccatgc tgagcctggc gagcatggcc caggtcttcc tgatgaacat gacgttcgac       660
     gtacccgtca agctattgtc ctttcatcta ctcctgataa gcctggtact gctcgccccc       720
     tatctggacc gcctgctcga tttctttgtg cggcaacgtg caagcgagcc gctgagccag       780
     cctccgctct tcaacgacca ccgcaggaac cgtctcgcca tctgggccca ggtgatgatc       840
     ggtctctggg tggcgctggg cggcgtctac gacggctgga ccacctggca cgagtacggg       900
     ggcggcggcc ccaagtccga gctttacggc atctggtcgg tgcaggcgtt cttcgtcgac       960
     ggaacgtatg tgccgcccgt cgccaccgat aggagccgtt ggcagacaat cattttcgac      1020
     cagcctgggg ccgctaccta tcagcgcatg aacggtgagc tggtggtggt gtcgaccgag      1080
     ttcgacgatg gtcatctgaa gctcgccgat atctcggaca actccggcgg aaaggtcggc      1140
     gggaaagcgc ccttcgcgga tctgacctac agccagccga atgtcgattc actgctgctg      1200
     ggcgggaagc tctacggcaa acccgtcaca gtcatgctga aacggatgga tccggagact      1260
     ttcccgttgc gcagcagagg cttccactgg gtacaggagt acccgttctt ccgctag         1317
//

If you have problems or comments...

PBIL Back to PBIL home page