(data stored in ACNUC30630 zone)

EMBL: CU458896.PE718

CU458896.PE718       Location/Qualifiers
FT   CDS_pept        complement(729689..730312)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0725c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5Z0L6_NOCFA 2e-79"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0725c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60821"
FT                   /db_xref="GOA:B1MHZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHZ9"
FT                   /protein_id="CAM60821.1"
FT                   /translation="MSEVVATGRRANRRGLATRESMLEAALRVLASGDPAAVSANKIAK
FT                   ECGATWGAVKYQFGDIDGLWAAVLQRTAERRGEQPWRNDPVGPLDRRVSAIVETLYRGL
FT                   TAPDSRAIENLRRALPPEPAELERLYPRTAAELASWKHRWARACQQAFDGLEVDPVRVR
FT                   EVAAFIPGAMRGLVSEKQLGTYSDLEEARRGLTNAIVAYLGGHE"
     atgagcgaag tggtggccac cgggcggcgg gcgaatcgtc gcggtctggc aacccgcgag        60
     agcatgcttg aggccgccct ccgagtgctc gcctccggag atccggcagc ggtgtctgcc       120
     aacaagatcg ccaaggagtg cggcgccacc tggggcgcgg tgaaatacca attcggcgat       180
     atcgacggac tgtgggcagc ggtgctccag cgcaccgccg agcgccgcgg cgaacaaccc       240
     tggcgaaacg atccggtggg tccgctggat cgacgggtca gcgcgatcgt cgaaaccctc       300
     tatcgcggcc tgaccgcccc ggactcacgc gcgatcgaga acctgcgccg ggcactgcca       360
     cccgaacccg ccgaactcga gcgtctgtac ccccgaacgg ccgccgagct ggcctcgtgg       420
     aagcatcgtt gggcgcgggc gtgccagcag gcgttcgacg gcttggaggt ggatcctgtc       480
     cgagtgcgcg aggtggcggc cttcatcccc ggcgccatgc gagggcttgt ttccgaaaaa       540
     cagctgggta cctattcgga tctcgaggag gcccgtcgcg ggctgaccaa cgcgatcgtc       600
     gcttacctag gaggtcacga atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page