(data stored in ACNUC30630 zone)

EMBL: CU458896.PE730

CU458896.PE730       Location/Qualifiers
FT   CDS_pept        complement(739729..740106)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0737c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q2JG92_FRASC 7e-27"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0737c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60833"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B1MI11"
FT                   /protein_id="CAM60833.1"
FT                   /translation="MSTAVTQLLAFTIDCSDASRLARFYADLTGGTVTGEYPEYGYASA
FT                   AIGSQNINFQGVQNYSSPQWPSQEHPQQFHLDFRVNDLGAAVDQATGLGATVASEQPGG
FT                   DSYRVMVDPDGHPFCLCPPKE"
     atgagtactg ctgttaccca actgcttgcg ttcaccatcg attgctccga cgcctccaga        60
     ctggcccgtt tctatgccga cctcacgggc ggcacggtca cgggtgaata tcccgaatac       120
     ggatacgcat cggcggcgat cggctcacag aatatcaatt tccaaggcgt acagaactat       180
     tcgtcaccac agtggcccag ccaggagcac ccgcagcagt ttcatctcga cttccgcgtg       240
     aacgacctcg gtgccgctgt cgaccaagcg acgggtctcg gtgccacggt tgcctccgag       300
     cagccaggcg gcgactccta ccgggtgatg gtggacccgg acggacatcc gttctgtctg       360
     tgcccaccca aggagtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page