(data stored in ACNUC30630 zone)

EMBL: CU458896.PE79

CU458896.PE79        Location/Qualifiers
FT   CDS_pept        complement(79114..79803)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0082c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q740C0_MYCPA 3e-67"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0082c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60182"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEB8"
FT                   /protein_id="CAM60182.1"
FT                   /translation="MAAISSPGEPNLAATSWTILGMLSYEEEVSGYDIKKWADWSISYF
FT                   YWSPSFSQVYSELRKLEKIGYATSRVDHDNGARSRRLYKITPAGMAAMSQWANETPAEP
FT                   QVLKHSVVLRVMQGHMTDPARLKEILERHIEYAENMQRRAALDAAGAAAQPAWAYSRVA
FT                   LKWAERYYAAERDLAMMMIEDLAEAAEEFDKAGPDGGTPRLVPGYWREVEKRVDAEKLS
FT                   TQHDTAD"
     atggcagcaa tcagttcgcc cggcgaaccg aatcttgctg ccacgagctg gacgatcctc        60
     ggcatgctgt cctacgagga agaggtttcc ggctacgaca tcaagaagtg ggccgactgg       120
     agcatcagct acttctactg gagcccgtct ttcagtcagg tctattccga gctgaggaaa       180
     ctggagaaga tcggctacgc cacctcgcgt gtggaccatg acaacggtgc ccgcagccgg       240
     cgactgtaca agatcacccc ggcgggcatg gcggcgatga gtcagtgggc caatgagacg       300
     cccgctgagc cgcaagtgct caaacacagt gtggtgctgc gtgtgatgca gggccacatg       360
     acagatcctg cccggctcaa ggagattctg gaacgacaca tcgagtacgc cgagaatatg       420
     cagcggcgcg cggcactgga cgccgccggt gctgcggcgc agcccgcctg ggcgtactcg       480
     cgcgtggcgc tcaagtgggc ggagcgctac tacgcggccg agcgcgatct ggcgatgatg       540
     atgatcgagg atctggcgga ggcggccgag gagttcgaca aggccgggcc ggacggtgga       600
     acacctcgcc tcgttcccgg ctactggcgt gaggtcgaga agcgagtgga cgccgaaaag       660
     ctttctacac agcacgatac ggcggactga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page