(data stored in ACNUC30630 zone)

EMBL: CU458896.PE81

CU458896.PE81        Location/Qualifiers
FT   CDS_pept        80364..81578
FT                   /transl_table=11
FT                   /locus_tag="MAB_0084"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q3RT45_RALME e-106"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60184"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEC0"
FT                   /protein_id="CAM60184.1"
FT                   /translation="MRWLAASALIGVSAVLVGCSPSPRPPADGEAASSAPFPDRRTPDG
FT                   AIIVTPDNFARAETDLYFGNIVKDGGFGTFHHIRELSPLDRQLVIRQNRDTLYSSAVFD
FT                   LDAGPVSISTPDPGQRFMSLQLITEDHYVPAVFYGKGQHTITKEQTGTRYIAAVVRTLV
FT                   DPGDPADLVQVHALQDGVSARQEKPGAFDVPKWDGASQRKVRDGLLQLAATLPDTTAMF
FT                   GAKATTDPVRHLIGTASAWGGNPEKDALYLTVNPAKNDGTTVYRLTVGPVPVDGFWSVT
FT                   VYNKDGYFTPNARNAYSLNNITARHGTGGQTTVQFGGCAPTTMNCLPITPGWNYMVRLY
FT                   RAQRRFSTAAGSFPRRCPSRRPNLMGCNDLGDLLGNFGAHIRVGHVIQAESRTQAGPHQ
FT                   PPAKL"
     gtgaggtggc tcgccgcgag tgcgttgata ggagtttcgg ccgtacttgt cgggtgctcg        60
     ccgtcgcccc gcccacccgc ggacggcgaa gctgcctcga gcgcgccttt cccggacagg       120
     cgcacacccg acggcgcgat catcgtgacc cccgacaatt tcgcgcgggc ggagacggat       180
     ctgtacttcg gaaacatcgt gaaggatggc ggttttggca cgttccatca catccgtgag       240
     ctgtcaccac tggaccgcca gctggtaatc cggcagaacc gcgacacgtt gtattcctcg       300
     gcggtgttcg atctggacgc cgggccggtc agcatttcca cgcccgatcc gggccagcgg       360
     ttcatgtcgc tgcagctcat caccgaagac cactacgtac ctgccgtttt ctacggcaag       420
     ggtcagcaca cgatcaccaa ggagcagacc ggtacgcgct acattgccgc ggtggtgcgc       480
     accctggtcg atcccggaga tccagcggac cttgtacagg tccacgccct gcaggacggt       540
     gtttcggcgc ggcaagagaa gccgggcgcc ttcgatgtcc ccaaatggga cggcgcaagt       600
     caacgaaagg tacgtgacgg tctgcttcag ctggccgcga cgctgcccga caccacggcg       660
     atgttcgggg ccaaggccac caccgacccg gtccgccatc tgatcggcac cgcctccgcc       720
     tggggcggga atccggagaa ggatgccctc tacctcaccg tgaatcccgc caagaacgac       780
     ggaaccacgg tgtaccggct cactgtcggg ccggtaccgg tggacggctt ctggtcggtc       840
     accgtctaca acaaggacgg gtacttcacg ccgaatgcgc ggaacgccta ctcactcaat       900
     aacatcaccg cgcggcacgg caccggcgga cagaccacgg tgcaattcgg tggatgcgca       960
     ccgaccacga tgaattgcct gcccattacg ccgggctgga actacatggt caggttgtac      1020
     cgggcgcaac gcaggttctc gacggcagct gggtctttcc cgaggcgctg cccgtcgcgt      1080
     agaccaaacc taatggggtg taacgatctt ggcgatctgt tgggcaattt cggcgcgcat      1140
     atccgcgtcg gacatgtcat ccaggccgaa tcccgcacgc aggctgggcc ccatcagccg      1200
     ccagccaagt tgtag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page