(data stored in ACNUC30630 zone)

EMBL: CU458896.PE9

CU458896.PE9         Location/Qualifiers
FT   CDS_pept        9849..10436
FT                   /transl_table=11
FT                   /locus_tag="MAB_0009"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60112"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME48"
FT                   /protein_id="CAM60112.1"
FT                   /translation="MNKQAGALALAVLGLAMGCQSQKTEPSGASSSSPEPTATTSSSSS
FT                   EAKTSGFQPFTPTTDACSLVAPEQLNSQGTAPITSRARESSNRIVQCSYKEAGGHEVLN
FT                   IKLFKNSDGAANFRSIHVRILESEGAQIYVMKDEPNECEAGLVNSEDNIVQFEFEPGDA
FT                   AVSSAALPAGQTWCDFSAPVLAEANKKLGWTK"
     atgaacaagc aagcaggggc actagcgctg gcagtgctgg gcctggcgat gggatgccag        60
     tcgcaaaaga cagagccctc cggagcatcg tcgagctccc cggagcccac agccaccacg       120
     tcttcatcct catcggaggc gaaaacttct ggcttccaac catttacccc cacgaccgat       180
     gcctgcagcc ttgttgctcc ggagcaactg aattcacaag gcaccgcgcc gatcacctcg       240
     cgcgccaggg agtcgtcgaa caggattgtt cagtgctcat ataaggaagc tggcggccat       300
     gaggtgttga acatcaagct gttcaagaat tcggatgggg cggccaactt ccggtcgatt       360
     cacgtccgga ttctcgaatc cgagggcgca caaatttacg ttatgaagga tgagccgaac       420
     gaatgtgagg cggggttggt gaactccgag gacaacatcg tgcagttcga attcgagcct       480
     ggagacgcag cggtctcttc ggcggcgcta cctgctggcc aaacgtggtg tgatttctct       540
     gcgccggtgc tcgcggaagc gaacaagaag ctgggctgga ccaagtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page