(data stored in ACNUC8465 zone)

EMBL: CU928166.PE100

CU928166.PE100       Location/Qualifiers
FT   CDS_pept        complement(204902..205501)
FT                   /locus_tag="KLTH0B02618g"
FT                   /old_locus_tag="KLTH-ORF15652"
FT                   /product="KLTH0B02618p"
FT                   /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
FT                   YLR009W RLP24 Ribosomal Like Protein 24"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21465"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF4"
FT                   /protein_id="CAR21465.1"
FT                   /translation="MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRN
FT                   PRKLRWTKAFRKAAGKELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQKRE
FT                   RAFYKNRMRGNKEREFLRDRQLVEKNPELLNMRDVELLRTAERAERVEAASDAESEEMD
FT                   VDSESEHESEDESEAEAQKQKVVLTNKRKVGKKIAF"
     atgagggtct acagttgtca tttctgctca tcgccatgct atccaggcca cggtatcatg        60
     tttgtgcgta acgacgcaaa ggagttccgc ttctgccggt ccaagtgtca caagaacttc       120
     aagcagcgcc gtaacccaag aaagctgcgg tggaccaagg cgttccgtaa ggccgcgggc       180
     aaggagctgg cggttgacag cacgctggcg ttcgctcagc gccgtaacgt gcccgttagg       240
     tacaataggg agctggttgc cacgactctg cgggcgatgg ctcgggtcga ggagatccgc       300
     cagaagcgtg agcgtgcgtt ctacaagaac cgtatgcgtg gaaacaagga gcgcgagttc       360
     ctgcgggacc gccagctggt ggagaagaac cccgagctgt tgaacatgcg cgatgtggag       420
     ctgttgcgca cggcggagcg cgcggagcgc gtagaggccg cgagcgacgc ggaaagcgag       480
     gagatggacg tggacagcga gtccgagcac gagagcgagg acgagagcga ggccgaggcc       540
     caaaagcaga aggtcgtgct cacaaacaag cgcaaggttg gaaagaaaat tgccttctaa       600
//

If you have problems or comments...

PBIL Back to PBIL home page