(data stored in ACNUC8465 zone)

EMBL: CU928166.PE101

CU928166.PE101       Location/Qualifiers
FT   CDS_pept        205524..206159
FT                   /locus_tag="KLTH0B02640g"
FT                   /old_locus_tag="KLTH-ORF15650"
FT                   /product="KLTH0B02640p"
FT                   /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
FT                   YLR008C PAM18 Constituent of the mitochondrial import motor
FT                   associated with the presequence translocase along with
FT                   Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
FT                   activity of Ssc1p to drive mitochondrial import contains a
FT                   J domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21466"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF5"
FT                   /protein_id="CAR21466.1"
FT                   /translation="MGCDAMRCPCRLSKNFFQLNFYSHFLPELENSLETGRRKAKWTGE
FT                   KDEKASNMAPIEAPQLAIPGEPSAVAPQAFNELVPATAAPVGSAKKSMDEKFDEALAFM
FT                   GRHPVMSGVGGFLGLYFAAGAFKSVSRMMGGGPKAAQFAKGGFDPKMNTKEALQILNLS
FT                   ENNLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGLRK"
     atgggatgcg atgcgatgag atgcccttgc agattgtcaa aaaatttttt ccagcttaat        60
     ttttatagcc attttcttcc agagctggaa aatagtcttg aaacaggcag aagaaaggcc       120
     aagtggacag gcgaaaagga cgagaaagcg agtaatatgg caccaatcga ggccccacaa       180
     ctggcgatcc ctggggaacc atccgcggta gcaccacagg catttaatga actggttcct       240
     gctacggctg cgcccgtagg gagcgcgaaa aagagcatgg acgaaaagtt cgacgaggcg       300
     ctggcgttca tgggccggca cccggtgatg agcggtgtag gcgggtttct gggactgtac       360
     ttcgcggcgg gtgcgttcaa gagtgtgtcg cgcatgatgg gcggcgggcc caaggctgcg       420
     cagttcgcta aaggcggatt cgacccgaag atgaacacta aagaggcgct gcagatcctg       480
     aacttgagcg agaataacct taaccgcaag aagctgaagg aggtgcaccg ccgcatcatg       540
     ctggcaaatc atccggacaa gggcggaagc ccttacctgg caactaagat caacgaagcc       600
     aaggactttc tggagaagcg cggcttgcgc aaatag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page