(data stored in SCRATCH zone)

EMBL: CU928166.PE102

CU928166.PE102       Location/Qualifiers
FT   CDS_pept        complement(206266..207135)
FT                   /locus_tag="KLTH0B02662g"
FT                   /old_locus_tag="KLTH-ORF15647"
FT                   /product="KLTH0B02662p"
FT                   /note="weakly similar to uniprot|Q07913 Saccharomyces
FT                   cerevisiae YLR007W NSE1 Essential nuclear protein required
FT                   for DNA repair forms a complex with Smc5p and Rhc18p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21467"
FT                   /db_xref="GOA:C5DCF6"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF6"
FT                   /protein_id="CAR21467.1"
FT                   /translation="MEVDAVREESGGDEAQLSYEDKGKFLLQYVLSRRGVCSEKALAKA
FT                   LKTLERDGEQLEDSETEAQVVKMVGRLNVRLSALDYKLVRQRDQLGAWMYAYVDVSPSG
FT                   DTKLATPLTIEELKYVQWCVREMLEAGQEVAEARGAKSAVERSVDEALVQSGSGRDELS
FT                   AEFDSKSLRFRVSYTAGARQLFQFDDLGPLETERLLTRLCQLRWFYRTNEGHFGLATRA
FT                   LSELQEYLRTQYTVPVCTVCDEVALRGVKCQCAEGAWHAPCFQHYVAHVSNACARCERP
FT                   VLEAIYMA"
     atggaagtag acgcagtccg ggaggaatct ggaggcgatg aagcgcaatt gagctacgaa        60
     gataagggaa agttcttact acagtacgta ttgagccgac gcggcgtgtg cagcgaaaag       120
     gcgcttgcca aagcactcaa gactctggag cgcgacggcg aacagctgga ggatagcgag       180
     accgaggcac aggtcgtgaa aatggtagga agacttaacg tcaggctaag cgccttggac       240
     tacaagctgg tgcgacagcg ggaccagctt ggcgcatgga tgtacgcgta tgttgacgtt       300
     tcaccgtcgg gggacaccaa gcttgccacg ccgctcacca tcgaggagct caagtacgtg       360
     cagtggtgcg tgcgcgaaat gctcgaggcc gggcaggaag tcgcggaggc gcggggcgcc       420
     aagagcgcgg tagaacggtc ggtggacgag gcgcttgtgc agtcaggcag cgggcgggac       480
     gaactgagcg cggagttcga ctcgaaatcg ctacggtttc gcgtgagtta cacggccggc       540
     gcacgccagc tattccagtt cgacgatctg ggaccactgg aaacagagcg gctgctgacg       600
     cgactgtgcc agctgcgctg gttttaccgg acgaacgagg gccactttgg gctagccacg       660
     cgcgctctct cagagttgca agagtacttg cgcacacaat acacggttcc agtatgcact       720
     gtgtgcgacg aggtcgcact ccggggcgtc aagtgtcagt gcgccgaggg tgcgtggcac       780
     gcaccctgct tccagcacta cgttgcacac gtcagcaacg cgtgtgcgcg ttgtgagcgg       840
     cctgtgctag aggccatcta catggcctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page