(data stored in ACNUC8465 zone)

EMBL: CU928166.PE104

CU928166.PE104       Location/Qualifiers
FT   CDS_pept        209215..211308
FT                   /locus_tag="KLTH0B02706g"
FT                   /old_locus_tag="KLTH-ORF15639"
FT                   /product="KLTH0B02706p"
FT                   /note="similar to uniprot|P27351 Saccharomyces cerevisiae
FT                   YJR005W APL1 beta-adaptin large subunit of the clathrin-
FT                   associated protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21469"
FT                   /db_xref="GOA:C5DCF8"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF8"
FT                   /protein_id="CAR21469.1"
FT                   /translation="MSELRLFSKCKAYEIRAELQQTNIKKHRASATKRKDALRKIIANL
FT                   SMGNFGEMALLFPDVLRFWQVEDDLEVKRICHHYLVAMAPTKSGHFATALSMVLEDFNS
FT                   GTEAVQILALRTLSSVPLPAYLEEASKCASAVLHQHSEPEALKKAALYALLRLAQLDSE
FT                   RSQLLMGIVGKVLQSAKEKPSVRAHALFVLYQEEESSSETRTMGLGRDLCLSMLELLPR
FT                   LNEWDNGRVLDALTANYVPQTHDDAHFMIDKALPQLQHANTSVVLNALKLIVFLTNYVD
FT                   RLSESIVKQLSSSVISLLNKPPELQFLVLRNVILLLLGREKPLLKVDVPYFFVEFNDPI
FT                   YIKDTKLEILYLLAKEDNLAQIFQELKEYATDIDIQMSRKAIRAVGNLAVKLKNSVDEC
FT                   INLLLDLLDFEVEYIVQEIISVFKNVLRRYPEKSKLCLYKLVRFTDSVQEPESRSSMIW
FT                   IITQYSSQLPNYFELFEGFSNNFLEESLEVQFTILSSTVKLFTRHPTPATEKLCINILK
FT                   SSTEKLDNPDLRDRAFMYWRLLSCTQKSGGNILTMDAVREVVDGNLPLITLNSRLDPHV
FT                   IEELELSIGTIVSIYLKPVNQVFRLNKPRVLPKSPALNSDKDNLEIIADDTRSHSSSFT
FT                   DDSSLASRRQSSSPVKKMDDYDRPAEVVNQLKLKRKTSSATSLLSRKPSVLGRKLSMKR
FT                   PFG"
     atgtccgaac tgcggctgtt ctcgaaatgc aaagcgtatg agattcgagc ggaattgcag        60
     caaaccaaca taaagaagca tcgagcctcg gcaacgaagc gaaaagatgc tctaaggaag       120
     atcatagcca acctttccat gggtaacttc ggcgaaatgg ccttgctttt ccctgatgtc       180
     ctccgcttct ggcaggtcga agacgattta gaagtcaagc gtatttgcca ccactactta       240
     gttgcgatgg ctccgacgaa gtccgggcac tttgcaacag cgttgtctat ggttttggaa       300
     gatttcaatt ccggcaccga agcagtgcag atccttgcct tgcgtacgct gtcttcggtg       360
     ccccttcccg cctatctcga agaggcctcc aaatgcgcga gtgccgtatt gcatcaacac       420
     tcagagcctg aggccttaaa gaaggcagca ctctacgcat tgttaaggct cgcgcaactg       480
     gattctgagc gctcacaatt gctcatgggc attgtaggca aggtgcttca aagcgcaaag       540
     gaaaagcctt cagtgcgggc tcacgctttg ttcgtgctct atcaagagga ggagagcagc       600
     agtgagacaa gaactatggg ccttggtcgc gacttgtgcc tctctatgct ggagttgcta       660
     ccgaggctca acgaatggga taatgggcgg gttttggacg ctctcacagc caactacgtg       720
     ccgcaaactc acgatgacgc gcattttatg atagacaaag cgctacctca gcttcagcat       780
     gctaacacgt ctgtggtttt gaatgctctt aagcttatcg tctttttaac gaactacgtt       840
     gaccgcttga gtgaaagcat tgtgaagcaa ctttccagtt ctgttataag tcttttgaat       900
     aaaccaccgg agttgcagtt tttagtgctc cgtaatgtca ttctgttgtt acttggtaga       960
     gagaaacctt tgctaaaagt tgacgttcca tacttttttg ttgagttcaa tgaccctatc      1020
     tacatcaaag acaccaagct cgagattctg tacctgcttg ccaaggaaga taacttggct      1080
     cagatttttc aagaacttaa ggaatatgcg actgatattg atattcagat gtctcgcaaa      1140
     gccatccgtg ccgttggaaa cctggctgta aagctcaaaa actccgtcga cgagtgcatc      1200
     aatctcttac tggatctcct cgactttgaa gttgagtata ttgtgcaaga aattatctct      1260
     gtgttcaaaa acgtcttaag aagatacccc gaaaagtcaa agctttgttt atataagctt      1320
     gtgcgtttta cagactccgt ccaggagccg gaatcacgta gctcaatgat ttggatcatc      1380
     acccagtact cgtctcaact tccaaactat tttgaattat ttgaaggatt cagcaacaac      1440
     tttcttgagg aatcactgga ggttcagttt acaatactaa gttcaacagt taaacttttc      1500
     accaggcatc ctacgccagc gacggagaag ctgtgcatca acattttgaa atcatcaact      1560
     gaaaagttag ataatcctga tttaagagac cgtgcgttca tgtattggag attattgtcc      1620
     tgtacacaaa agtctggagg aaatattcta accatggacg cggttagaga ggtggttgac      1680
     gggaacttac ctctaatcac tcttaactcc cgtttggatc cacatgttat tgaagaatta      1740
     gagctcagca ttggcactat tgtttccatc tacctaaagc ccgtcaacca agttttcagg      1800
     ctaaataagc caagggttct gccgaaaagc cccgccctaa actcagataa agacaacctg      1860
     gaaattatag ctgatgacac tcggagtcac tcttcgagct ttaccgatga tagctcgttg      1920
     gcatctcgca ggcagtcctc ttctcctgtc aaaaaaatgg atgattatga caggccagca      1980
     gaggtcgtga accagctgaa gctgaaaaga aaaaccagta gcgccacttc tcttttgtcc      2040
     agaaaaccat ccgtacttgg aagaaagcta tctatgaaaa gaccatttgg ttga            2094
//

If you have problems or comments...

PBIL Back to PBIL home page