(data stored in SCRATCH zone)

EMBL: CU928166.PE107

CU928166.PE107       Location/Qualifiers
FT   CDS_pept        214541..217132
FT                   /locus_tag="KLTH0B02772g"
FT                   /old_locus_tag="KLTH-ORF15629"
FT                   /product="KLTH0B02772p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21472"
FT                   /db_xref="GOA:C5DCG1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG1"
FT                   /protein_id="CAR21472.1"
FT                   /translation="MNVLLSFLALSKFFLLAIAVPVRDDDLYTEMVEAQLDEEFEEQVE
FT                   RTEVRSSGFESSPGATGRALFGLSDGLFEEFPFLNYVDVFYGTEGGGHMFPGTTVPFGM
FT                   CKMGVDVLHPHSTDAYSGYHSTGDVCGISMLHESGTGGSPTYGVVSQLPLMASSASDVD
FT                   TSRQIAFPRSKPDAGHIGYYRVSLSNRVTIEFSSNSRSGLYKYTFPTKHQQHHMSPIVM
FT                   VNVTQHLHSVKRPWWTQNFEGGYIKVDKSYKSYRGKAYFSGGWSDPGTWSVSFYGVFDK
FT                   PAKRVRAFHGSKAYNRLRLNLAKSLNSNMGMLFEFEKGTKVLYSHVGVSFSETDGINVA
FT                   RQNLALNYPEENMFDLHWSVRSTAEAWDNEVFSKVNIDESKEDPIIVEKMYNALYGSHL
FT                   MPSDKSGREAPWPTNEPYYDDWFTLWDTFRCLHPLLNILNTKRSADMTRSLIEIWRKEG
FT                   YMPDGRSASRSGRTQGGSNADIVLADAFVKGVGEGVDWQDGFSAMRSNADKSPEYILDK
FT                   AAPDSTNKYGRGALNDWLELGYITRRFSRSVTRTMEYAYNDFALSVVAEGLGYFELAKQ
FT                   YLKRSSNWQNIWNFEATTPEYDYSGFIQPKDSNGNFIEKKYNPLSCFGCYWRDDEYEGK
FT                   PIEYGWAVPHDIQSLKEFIGPDELFMRRLDDMFDLYGDGIADIGNEPSFLTPYLFNFIN
FT                   AQYRTSETLGYLIDHKFLLGPKGLPGNSDAGAMQAWLWFGLVGFYPIAGTDIYLITSPK
FT                   ITELEIQLEGNGKALIQAHNLYAEDADSEYDYDKAHSSFTRNLYISSVELNGKLINRNW
FT                   FTHEELFGSNGGLLVFTMTDEPTFWDADGEYPPSRGHFQRDDIERPNRLVD"
     atgaatgtat tattgagctt ccttgcgctg agcaaattct ttttactggc gattgcagtt        60
     ccagtgagag atgatgacct ttacacggag atggtcgagg cacaactaga tgaagagttc       120
     gaggagcagg tcgagagaac agaggtgcgg tcatctggct ttgagagcag ccctggtgcc       180
     accgggaggg ctctgttcgg gctgtctgac gggctcttcg aggaattccc gtttctcaat       240
     tacgtcgacg tgttttacgg cacagaaggc ggcggccaca tgtttcctgg aacaactgta       300
     ccgtttggga tgtgtaagat gggagttgac gttctgcatc cgcactccac ggacgcgtac       360
     tctggctacc actctacggg cgatgtctgc ggcatttcga tgctccacga gtctggaacc       420
     ggcgggtcgc caacgtacgg ggtcgtttct cagcttccgc taatggccag cagtgccagt       480
     gatgtggaca ctagtagaca gatcgccttc ccacggtcta agccggacgc cggccacata       540
     ggctactaca gggtcagtct ctccaaccgt gtcacgattg agttttcttc caacagccgc       600
     tccgggcttt ataagtacac gttccctact aagcatcagc agcatcatat gtcacctata       660
     gtgatggtca atgtcacgca gcacttgcac tcggtaaaga gaccgtggtg gacgcagaat       720
     ttcgaagggg gctacatcaa agtggacaaa tcgtacaagt cctacagagg caaagcttat       780
     ttctcgggcg ggtggagtga cccaggcact tggagcgtca gcttttatgg tgtgtttgac       840
     aagcctgcaa aaagagttcg cgctttccat ggttccaaag cctacaaccg tctcagatta       900
     aatttggcta aaagcctaaa ctcaaatatg ggtatgctct ttgagttcga gaagggcact       960
     aaggttcttt attcacatgt cggggtcagc tttagcgaaa cggatggcat taatgtggca      1020
     agacaaaacc ttgcactgaa ctacccggaa gaaaacatgt tcgatcttca ctggagtgtc      1080
     agaagtacgg cagaagcctg ggataatgag gtgttttcta aagtcaacat tgatgaatca      1140
     aaagaagatc ccattatcgt ggagaaaatg tataatgccc tttatggttc tcacctcatg      1200
     ccgtcagaca aatcaggacg cgaagcgcca tggcccacaa acgagcctta ttatgatgat      1260
     tggtttacac tctgggacac tttcagatgt cttcatccgt tgctgaacat cttaaacacg      1320
     aaaagaagcg ccgatatgac acgcagcttg atagaaattt ggagaaaaga aggctatatg      1380
     ccggacggcc gatctgctag tcggagcggc aggacccagg gcggcagtaa cgcggatatc      1440
     gttctagcag atgcatttgt aaagggagtg ggagaaggtg ttgattggca ggacgggttc      1500
     agcgctatgc gatcaaatgc tgataaaagc ccagaatata ttttggacaa ggccgcccca      1560
     gactctacaa acaagtatgg tagaggtgcc cttaatgact ggctggaact aggatatatc      1620
     actagaagat tttctcggtc agtaaccaga acaatggaat acgcttacaa tgattttgcc      1680
     ttatcagtag ttgcagaagg actcggttac tttgaattag cgaagcaata cttgaagaga      1740
     tcttccaact ggcagaatat atggaatttt gaggcgacca cgcctgaata cgactacagc      1800
     ggttttatcc agcccaaaga ttctaatggc aattttatcg agaaaaagta caatcctctg      1860
     tcttgcttcg ggtgttactg gcgtgacgat gaatatgaag gaaagcctat agaatacggc      1920
     tgggctgtac cgcacgacat tcaatctctt aaagaattca ttggtccaga tgagctgttt      1980
     atgcgtcgcc ttgacgacat gttcgacctg tatggagatg gaatcgcgga catcggtaat      2040
     gagcctagct tcttaacacc ttacctgttc aacttcatca atgctcagta tagaacatcc      2100
     gaaacccttg gttaccttat cgaccataag ttccttctcg gtcctaaggg cctccctgga      2160
     aactccgatg caggggccat gcaagcttgg ctatggtttg ggcttgtcgg gttctatcca      2220
     attgccggaa ctgacattta cctgataacc agccccaaga ttactgagct agagatccaa      2280
     cttgagggga atggtaaagc tttgatacaa gcccacaatt tgtacgcaga agatgctgac      2340
     agtgaatacg attatgacaa agcacacagt tcttttactc gtaatctcta catttcaagt      2400
     gttgagttga atggaaaact catcaaccgt aattggttca ctcacgagga gctttttgga      2460
     agcaatggcg gtctgttggt ctttaccatg actgacgaac caaccttttg ggacgccgac      2520
     ggtgagtatc cgcctagcag aggccacttt caaagagatg acatagagcg gccaaatcgg      2580
     ttggtagatt ag                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page