(data stored in ACNUC8465 zone)

EMBL: CU928166.PE110

CU928166.PE110       Location/Qualifiers
FT   CDS_pept        223097..225583
FT                   /locus_tag="KLTH0B02860g"
FT                   /old_locus_tag="KLTH-ORF15618"
FT                   /product="KLTH0B02860p"
FT                   /note="some similarities with uniprot|P20840 Saccharomyces
FT                   cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
FT                   binds to Aga1p during agglutination N-terminal half is
FT                   homologous to the immunoglobulin superfamily and contains
FT                   binding site for a-agglutinin C-terminal half is highly
FT                   glycosylated and contains GPI anchor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21475"
FT                   /db_xref="GOA:C5DCG4"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR024672"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG4"
FT                   /protein_id="CAR21475.1"
FT                   /translation="MLCRMLALVLATSFFLGHTLATQIKSVSFEGLSIDSISSQSFPHK
FT                   MWELSFEFTIEDVNQISESDYFLLDLPHVYRVKFSNDADYQYITMADGSDAFKCYASQQ
FT                   AAYKYGSSVLRCDAVRTFSSFTSLRGNLSIGAVFSNGGSSYEFELENSKYFKSGEQLVE
FT                   LSEKLSAVANFARAPDFDSYYYEGRTTTYGSMESYYLGLSCPDGYILGGTQVIDYSPGT
FT                   QPSSFDCSDAQVQLSSDFNDWFFPESYQSFSGDYVCNGATLSISFDKIDSGKRIWVNNL
FT                   QYLDASASTVYHSIYFDYTCTNTLSSLVYTTAVHQSPAFVIKDGVFTGSAVVDALSTSA
FT                   ILTTTTTTTTTWKSAYATTTTGSVSSGATVITIHVDTPGTSSTQSFSSSRSDSSESIIA
FT                   STSSDFSKPTTSTLTVTSCVSNRCSKLELISPSTSSIVSIVTSSPSESSTSPSESSTPS
FT                   SASSTSPSESSTPSSASSTSSSVSSTPSSVSSTPSSVSSTPSSESSTSPSESSTSPSES
FT                   TTSTPITTFANRTSAPPSTGHYSSTISTPGFPSSARGSQSISFGTVPFTELSYSVSTSR
FT                   PSSLVLTSTTLKSTSPTSSLSGSSPCLGTACFETVSFVKPSDSSPPSHPASTSSTRPTM
FT                   QTGTTTMEFQTSSSSISASKFTDSKLLSSGGVSKATSSFSESTAATWKVTSSITKSTAS
FT                   SLDKSIVTTPSLTTNIIKSSETGTQSDLASSDSSQVERPGSSNGGVITSTTHLSKASSN
FT                   AFLGSIAASSFSSSSDSATTTTKVSAQITSTPSLVLSSTSAFSSASFSVYEGLAARHKF
FT                   QVTLGALASLVLYSFT"
     atgctttgca gaatgctcgc cttggtctta gccacctcat ttttcttggg ccatacatta        60
     gccactcaaa taaaatccgt tagttttgaa gggctctcaa ttgattccat cagttctcag       120
     tctttccctc acaaaatgtg ggagttgtcg ttcgaattta cgattgagga tgtcaaccaa       180
     atttcagaaa gcgactactt tctgctagac cttcctcatg tttatcgcgt caagttcagt       240
     aatgacgctg attatcagta cattacaatg gccgatggat ccgacgcctt taaatgctat       300
     gcttcgcaac aagcagcata caagtacggg tcatctgttt tgagatgcga tgctgtcaga       360
     acattttcct cattcacctc cttgcgggga aacctttcta ttggtgccgt attcagcaac       420
     gggggttctt cttacgaatt tgagcttgaa aactctaaat actttaagag tggagagcag       480
     ttagtggagc ttagtgagaa gctgagcgct gtcgcaaatt ttgcgcgagc cccagacttt       540
     gacagctact actatgaggg gcgcacgacc acgtatggca gcatggaatc ctattatctg       600
     ggcctctcct gccctgacgg gtacattctc ggtggcactc aggttataga ctacagcccg       660
     ggaacgcagc ccagtagctt cgactgttct gacgctcagg ttcaattatc aagtgacttc       720
     aacgactggt tctttcctga aagttaccaa tcgttttcag gggattacgt ttgtaatggt       780
     gcgacgcttt caatttcatt tgacaaaatt gactctggaa aacgtatttg ggtgaacaat       840
     cttcaatatc tcgatgcttc ggcttcaact gtttaccaca gtatctattt tgattacaca       900
     tgcaccaaca ctttgtcaag cttagtttat acaacagcag tgcatcaatc tccagctttt       960
     gtcattaaag atggcgtttt caccggaagt gcggtagtgg atgcactttc gacttctgct      1020
     attttaacca cgaccacaac tactactaca acttggaaaa gtgcctacgc tacaaccaca      1080
     accggttcag tgagctccgg ggccacagtt ataacgatac acgttgatac tccaggaaca      1140
     tcctctacac aatcttttag ctcctcccgc agtgattcat ctgagtcaat aatagcgtcc      1200
     acgtcttctg atttttcaaa gccaacaaca agcacattga ctgtaacatc ttgtgttagt      1260
     aaccgatgct ccaagctaga actcatatcg ccctcgactt cctcaattgt gtcaattgtc      1320
     acatcatctc ccagtgagtc gagtacatct cccagtgagt cgagtacacc ttccagtgca      1380
     tcgagtacat ctcccagtga gtcgagtaca ccttccagtg catcgagtac gtcttccagt      1440
     gtatcgagta caccttccag tgtatcgagt acaccttcca gtgtatcgag tacaccttcc      1500
     agtgagtcga gcacgtctcc cagtgagtcg agtacgtccc ccagtgagtc gacaacttcc      1560
     accccgatca caacctttgc caaccgtacc tcagcaccgc cttcaacggg gcactattca      1620
     agcacaatat caactccagg cttcccatct tcggcccgag gcagtcagtc tatttcattt      1680
     ggtaccgtcc cgtttaccga attgtcatat tcagtttcaa catccagacc atctagcctt      1740
     gtcttgacct caactactct gaagtcgacg tcaccaacgt cttcattatc aggctcctct      1800
     ccatgtctag gaactgcgtg ctttgagaca gtctcattcg tgaagccttc ggactcatct      1860
     ccgccttctc acccggctag cacatcttcg acaagaccaa caatgcaaac cggaactacc      1920
     actatggaat tccagacctc tagctcgagc atttccgcct cgaagtttac ggattctaaa      1980
     ttattaagtt ctggcggggt ttccaaggcg acttctagct tcagcgaaag cactgcggcc      2040
     acttggaaag ttacttcctc aattacaaaa agcacggcaa gttcgctgga caagagcatt      2100
     gtcacgacac cttccctaac gacaaacatc ataaaaagta gtgaaacagg aactcagtct      2160
     gatttagctt catcggattc atcgcaggtc gagcggcctg gttcctccaa tggaggcgta      2220
     ataacttcaa ccactcatct ttctaaagca tcctcaaacg ctttcttggg gagtattgca      2280
     gcttcttcat tttcatcaag ttcagacagt gcaactacta caacaaaagt ttccgcgcag      2340
     attacgtcaa ccccttcatt ggtactgtct tctacgagtg cattttcttc ggcttcgttc      2400
     tccgtttatg agggtttggc tgctcgtcac aagttccaag tgacacttgg tgccctagcg      2460
     tccttggttc tctactcatt cacatga                                          2487
//

If you have problems or comments...

PBIL Back to PBIL home page