(data stored in ACNUC8465 zone)

EMBL: CU928166.PE112

CU928166.PE112       Location/Qualifiers
FT   CDS_pept        complement(227825..228442)
FT                   /locus_tag="KLTH0B02904g"
FT                   /old_locus_tag="KLTH-ORF15612"
FT                   /product="KLTH0B02904p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21477"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG6"
FT                   /protein_id="CAR21477.1"
FT                   /translation="MTFRLIMVDPSPSSKEHLDFSTEKPESVKQHDARGSSKRRKDLSV
FT                   VMHTFEKGRVEKVSPPCRGICTKKKNHKNAAAAKPSEKRCKKLEGVQDEEKMNSSCVIP
FT                   PKPLTFVTSVASDYSLEYANAWQSSLEFNSKKAQRPLFRITKYKGRKGCEKVESSTELL
FT                   GTIDPNFCFSYNSLNSSKEKGAKTPPMNFSTAPVFKVLLNDR"
     atgacattta gactcataat ggtcgaccct agcccttcta gtaaagaaca tctcgatttc        60
     tcaactgaaa aacctgaatc agtgaagcag catgatgctc gtggctcaag taaaagacgt       120
     aaagacttat ccgttgtcat gcatactttt gaaaagggca gggttgaaaa ggtttcccca       180
     ccctgccgag ggatttgcac caagaaaaag aaccataaaa atgctgccgc cgcaaagcct       240
     tctgagaaac gttgcaagaa attagaaggg gttcaagatg aggaaaagat gaactccagt       300
     tgcgttatcc caccaaagcc acttactttc gttacttctg ttgctagtga ttactcactg       360
     gagtatgcta atgcgtggca gtcctctctt gagtttaata gcaagaaagc acaacggcct       420
     ctatttcgaa tcacgaaata caagggaagg aagggctgcg agaaagtgga aagctccact       480
     gagcttctcg ggacaatcga cccaaacttt tgcttttctt acaactctct caacagttca       540
     aaggagaaag gcgcgaaaac ccctcctatg aactttagta cagctcccgt attcaaagtt       600
     cttctcaatg atcggtag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page