(data stored in SCRATCH zone)

EMBL: CU928166.PE120

CU928166.PE120       Location/Qualifiers
FT   CDS_pept        complement(join(242293..242875,242960..243024))
FT                   /locus_tag="KLTH0B03102g"
FT                   /old_locus_tag="Klth0B.mRNA.1545.m"
FT                   /product="KLTH0B03102p"
FT                   /note="highly similar to uniprot|P38624 YJL001W
FT                   Saccharomyces cerevisiae PRE3 20S proteasome beta-type
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21485"
FT                   /db_xref="GOA:C5DCH4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037559"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH4"
FT                   /protein_id="CAR21485.1"
FT                   /translation="MNGIQVDINHLKKGEVSLGTSIMAVTFRDGVILGADSRTTTGAYI
FT                   ANRVTDKLTRVHEKVWCCRSGSAADTQAVADIVQHYLELYTAQFGEPSTKTAASIFKTL
FT                   CYENKDNLTAGIIVAGYDEKNKGEVYSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKE
FT                   NMSKDETVSFMKNSLSQAIKWDGSSGGVIRMVVLTKDGAERLIFYPEDYENL"
     atgaacggca ttcaagttga tatcaaccat ttgaaaaaag gcgaagtcag tttgggcacc        60
     tctataatgg ccgttacttt cagggatggc gtgattctcg gcgcagactc gagaactact       120
     actggtgcgt atattgccaa tcgggtcacc gacaagctta cgagggtaca tgaaaaagtg       180
     tggtgctgca gatccggatc tgcagcagat actcaagcag tcgcagacat tgtacaacat       240
     tacctcgagc tctatactgc tcaatttggt gaaccatcca caaaaactgc tgcttctatt       300
     ttcaaaacac tatgttatga gaacaaagat aacctgacag cgggcattat tgtcgcaggc       360
     tatgacgaga aaaacaaagg tgaagtttac agcataccgc tcgggggatc tgtccataaa       420
     caaaaatatg ccattgctgg gtctggttct acattcatct acggttattg tgacaagaat       480
     tataaagaga atatgtcgaa ggacgaaact gtgtctttca tgaagaattc tctgtcgcaa       540
     gctatcaaat gggacggctc gtcaggtggc gtaattagaa tggttgtttt gacaaaggat       600
     ggtgctgaac gtctcatttt ttaccctgaa gactacgaga acttgtag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page