(data stored in ACNUC8465 zone)

EMBL: CU928166.PE123

CU928166.PE123       Location/Qualifiers
FT   CDS_pept        complement(247739..249631)
FT                   /locus_tag="KLTH0B03168g"
FT                   /old_locus_tag="KLTH-ORF15583"
FT                   /product="KLTH0B03168p"
FT                   /note="similar to uniprot|P54790 Saccharomyces cerevisiae
FT                   YLL004W ORC3 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21488"
FT                   /db_xref="GOA:C5DCH7"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH7"
FT                   /protein_id="CAR21488.1"
FT                   /translation="MSLNEFAEAQKTHYTVCPKVKRRRISCEKGIDPFVKLLAGKESMQ
FT                   MVNKRWVLYHQLHSQFHAQVEEIVHRVSIDMYREISSVLSKDTSKRTSPSFNCLFLLGS
FT                   DSTTTIELHEQNSKTMQAIIDLTPKESPNVRMMLRRSMFKLLSATEAPLRVKTDEKESF
FT                   APEGDMGELPRTSPLGISYDLSLVQNFRKLFGKRLKLIFNFKDVDSFNSQVLDDFIILL
FT                   KSALNYKDVEICLVLNINTNLSNIQKNLRQSTIRLLKKDFTVIDLSHNKGHKYANQTFQ
FT                   SFLNTVDGKLNLSAEFIKFILDKMSNNATHNLQLLIKILDYSLMSYFFQNPFSVFIDPT
FT                   NVVNFDENYLPPLLKCPTFMTFVEGMVHAHAPSEEIMALLDNKNSTLEEFFTEFLVREN
FT                   PINDHLKLVVDVLENQLGVFNYNLIDLYYHMLTGKLHEFLQRWPECQQFEDILKFEPVD
FT                   IIFQELFTLDNSKELFSQSLFPFLRTNLENNLINSDRMLPPAKRLPGIKDPFEAEFNSS
FT                   VDLPLCQLFSLYREASSIINLYDFFLAFKETLPRSEIANFVNYSVENKESDLRHEDREK
FT                   LSILLKEKGLDNLLDKMMLVWFVQSISEFQHMGLLKTQSNKSYEVVEKCIWRGL"
     atgagcctca acgagtttgc ggaagctcaa aagacacact acacagtatg ccctaaagtc        60
     aaaagaagga gaatatcatg tgagaaaggg attgatcctt tcgtgaaatt gctggcaggc       120
     aaagaatcca tgcagatggt taacaagcga tgggttcttt atcatcagct tcattcccag       180
     ttccatgcgc aggttgaaga aattgttcac agagtcagta tagacatgta ccgagagatt       240
     tcaagcgtgc tttccaagga cacaagcaaa cgaacgtcac cctcattcaa ctgcctcttt       300
     ctacttggct cggatagtac aacaacaata gaactgcatg agcaaaattc taaaacgatg       360
     caggccatca tagacctaac tccaaaagag tcccctaacg ttaggatgat gttgagaagg       420
     tcaatgttta agctcctgag cgcaacggaa gcccccctgc gagttaaaac tgatgagaaa       480
     gaaagctttg cccctgaagg agatatgggt gagctgccac gaacatcccc actcggaatc       540
     tcatatgatc tctccctcgt tcaaaatttt cggaagcttt ttggcaagag gctgaaactt       600
     atatttaact tcaaagatgt tgattcattc aattcccaag ttcttgatga tttcataatc       660
     ctactaaagt ctgctttgaa ttacaaagat gttgaaatat gccttgttct gaacataaac       720
     acaaatctat cgaacattca aaaaaatttg cggcaatcaa ccattcgtct cttgaaaaaa       780
     gacttcacag tcattgacct ctctcataac aagggccaca aatatgcaaa ccagaccttt       840
     cagagctttc tgaacactgt tgatgggaag ctaaacttat ccgcggagtt catcaagttt       900
     attctcgata aaatgtccaa caatgctaca cataatctcc agctgctaat aaaaatcctg       960
     gactattctc ttatgtctta tttcttccaa aatccgtttt ctgttttcat tgatccaacg      1020
     aatgttgtga actttgacga aaactactta cctccgctcc tgaaatgtcc tacattcatg      1080
     acttttgttg aaggtatggt acacgcgcat gcaccctctg aggagataat ggcattacta      1140
     gataacaaaa actcaactct ggaggagttt tttaccgagt ttcttgtacg agaaaatccc      1200
     atcaatgacc atttgaagtt ggttgtcgat gttctcgaga accaactagg agtcttcaac      1260
     tacaacctga tagatcttta ctatcatatg cttactggga agttacatga atttttacag      1320
     agatggcctg aatgtcaaca gttcgaggat attttgaagt tcgagcctgt ggacataata      1380
     tttcaggaac ttttcacact ggacaacagc aaagaacttt tttctcaatc cctatttcca      1440
     tttcttagaa caaacctgga aaacaaccta atcaattccg atagaatgct gccgccagcg      1500
     aaaaggctcc cggggataaa agatcctttt gaggccgagt tcaatagtag cgtagatcta      1560
     ccactttgcc aattattcag tctctacaga gaagctagtt cgatcataaa cctctatgat      1620
     tttttcttgg ctttcaagga aaccctaccc agatccgaaa tagcgaactt tgtaaattac      1680
     agcgtggaaa acaaggaatc cgacctgcgt catgaggata gggagaagtt atcgatcttg      1740
     ctaaaagaaa aaggcctcga caatttgttg gacaagatga tgttggtctg gttcgtgcag      1800
     tcgatatccg aatttcagca catgggtcta ttaaaaaccc aaagcaacaa atcttacgaa      1860
     gtcgttgaaa aatgtatatg gagggggctt taa                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page