(data stored in ACNUC8465 zone)

EMBL: CU928166.PE124

CU928166.PE124       Location/Qualifiers
FT   CDS_pept        complement(250346..250702)
FT                   /locus_tag="KLTH0B03190g"
FT                   /old_locus_tag="KLTH-ORF15582"
FT                   /product="KLTH0B03190p"
FT                   /note="highly similar to uniprot|P47081 Saccharomyces
FT                   cerevisiae YJL003W COX16 Mitochondrial inner membrane
FT                   protein required for assembly of cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21489"
FT                   /db_xref="GOA:C5DCH8"
FT                   /db_xref="InterPro:IPR020164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH8"
FT                   /protein_id="CAR21489.1"
FT                   /translation="MSFGDRKFRSRRQQLAYEASIAGKYQARMKKNPFLYFGLPFCSII
FT                   VLGSYWLSGFTAVRYEQKDRKIQEMSEDDLVKMKANKRQFDIKEEYYRLQGLGEQDWEP
FT                   VRVPRMKGESENVW"
     atgtcattcg gagataggaa gtttaggtcc agacgacagc aacttgccta tgaagcctct        60
     atcgccggta agtaccaggc tcgtatgaag aaaaatccct ttctgtactt cgggctgcct       120
     ttttgctcaa taatcgttct aggctcctac tggctttctg gttttactgc agttagatat       180
     gaacagaagg accgcaaaat tcaagagatg agcgaagatg atttagttaa aatgaaggca       240
     aacaagagac aatttgatat aaaggaagag tattatcgtt tacaggggct tggtgagcaa       300
     gattgggagc ctgtacgagt ccctaggatg aagggggaat cagagaatgt ctggtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page