(data stored in SCRATCH zone)

EMBL: CU928166.PE125

CU928166.PE125       Location/Qualifiers
FT   CDS_pept        250834..253770
FT                   /locus_tag="KLTH0B03212g"
FT                   /old_locus_tag="KLTH-ORF15581"
FT                   /product="KLTH0B03212p"
FT                   /note="some similarities with uniprot|Q07798 Saccharomyces
FT                   cerevisiae YLL005C SPO75 Meiosis-specific protein of
FT                   unknown function required for spore wall formation during
FT                   sporulation dispensable for both nuclear divisions during
FT                   meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21490"
FT                   /db_xref="GOA:C5DCH9"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH9"
FT                   /protein_id="CAR21490.1"
FT                   /translation="MPKCCLYSLLPVSAKMASMLGSNQNTPKPEFAKCIQPIIETDYMT
FT                   TAISMDFNTASFRSENRHYSITESILTTFLNTTRAGSAQKHTGMSFDALISSLVVSIVY
FT                   CGLQTLLFTMLRGKLKTLYQTRNFQLSEANEMRSLQENGPLGWVKSAWKTPLNEYKRAN
FT                   GLDSFFFLRFMKAFGLFFLSLSVINIPVLIPIHYCSGAKVLRQRCKIDSLQAFNETEAR
FT                   LTSHFLEIEDSLKAQGLDKLSISNVSLQHADRLIFHFILAAFVVLWFHALLIKELKFFI
FT                   AERNKALSNNEVPGSFYQSVLFLDNIPRDMFLNRAQLPKLFRFADSNDIQLTFLPTNYQ
FT                   RLKKYYQKDKKIIDKLEHLQLKLIVLQSNQCGTQKALPPNERAVSGFATDVSDKYAVRT
FT                   NKLGRKAESAQQCYGPERSKKIYNNGTARKIRKEKVSRYGCARWASKLRLSSHNLNITI
FT                   KHISKQKSHIKINTRWLRALGIPSSFNIIKFRLNKDQARESLMKALEKLATELIQNREK
FT                   WKELSEKPTPFVADGDQKQEEHPKKLFITFKSSRTAHLFAQVLISDKFKELNNVIIGPN
FT                   PIDMIWSNVIQSSRWLKVVRIIFADLIAVLVILGWVLPVAFVGLISQVPNMKILVPFFT
FT                   WLDSDNAFFSSVLSSLVPILFLIFLIDIVPFIFRWLSILKVNRTGAEIELDVQRWLFVF
FT                   FFVHIFLVVTVSSGISVIFEKLINNPTSLPDLLAANLPKSSNFFYSFIFIRGLAYFGGN
FT                   LLQVKELLFELFYYRWCIRTPRKVRKRMEVVSENMWGSVYPLFSTIASIGIVYSVIAPL
FT                   VLIFATVTFLIVQFSFKCRLNHQQHSRGKSETFGKLYPQALMQSYAGIYCLEICMIGLF
FT                   ALSNRYVLVICMALVFIFTILAHFKISKFYDKYINFLPLKEDEESLLTEHPRKDLFPFF
FT                   VKEKCLWIPQDSSGASNDQCHLMNEKFDIFCRNEGCFFDGATGSLNFL"
     atgccaaaat gttgtttata ttctctgctg ccagtttcag cgaaaatggc ttcgatgctt        60
     ggttccaacc aaaacacccc caaaccagaa tttgccaaat gcatccaacc tatcatagaa       120
     actgactaca tgacgaccgc tatatcaatg gatttcaata ctgccagttt cagaagtgaa       180
     aatagacact atagcattac ggaaagtatt cttaccacct ttctaaatac aacaagagcg       240
     ggctcggcac agaagcacac tggcatgtca tttgatgctt taatatccag tctcgtagtt       300
     tcaatagttt actgtggctt gcagacgctt ctattcacca tgttgcgggg aaagcttaag       360
     acgctttatc agacgcgtaa ttttcaattg tcagaggcca atgaaatgcg ctcgctacaa       420
     gaaaacggac cactaggctg ggtaaagtct gcttggaaaa ctcctctcaa cgaatacaag       480
     cgagccaacg gccttgattc cttttttttc cttaggttca tgaaggcatt tggattattt       540
     tttctgagtc tatccgtaat caatattcct gttcttatcc ccatccatta ttgttcaggg       600
     gccaaggtat taaggcaaag gtgtaaaata gatagtttgc aagcctttaa cgaaactgaa       660
     gcgagattaa catcacactt tttggaaata gaggattcct tgaaggcaca agggctcgat       720
     aaactctcaa tctctaacgt ttcactacag catgccgaca ggttaatttt ccacttcatt       780
     ctcgcagcgt tcgtcgtgct atggtttcac gcactattaa tcaaggagtt aaaattcttt       840
     attgccgaaa gaaacaaagc tctttcaaat aacgaggtcc caggatcctt ctaccaatca       900
     gttctattcc tagataacat accaagggat atgtttttaa acagagcaca gcttcccaag       960
     ctgtttcgtt ttgcagactc aaatgatata cagctgactt tcttgcctac aaactaccag      1020
     cgtttgaaaa agtattacca aaaagataag aagattattg acaagttgga acatctccag      1080
     cttaaactga ttgtacttca gtcgaaccag tgtggtactc aaaaagcact ccctcctaac      1140
     gagcgtgctg tctccggctt tgcaacggat gtttctgata aatatgcagt acgcacaaac      1200
     aaactcgggc ggaaagctga gagcgcccaa cagtgctacg gacccgagcg ttcgaaaaaa      1260
     atctataata atggcactgc taggaaaatt cggaaagaaa aggtgtcaag atatggatgc      1320
     gctcgctggg ctagtaaact tcgattgtct tctcataatt tgaacatcac aataaagcac      1380
     atatctaagc aaaaaagcca catcaagatc aacacaagat ggcttcgagc cttagggatt      1440
     cccagttcat ttaatattat taagttcaga ctcaataagg atcaggccag agaatcacta      1500
     atgaaggccc ttgaaaaatt ggcgactgag ctaattcaga atcgagaaaa gtggaaggaa      1560
     ttgagcgaga agccaacacc gttcgtggca gatggagatc aaaagcagga agagcaccca      1620
     aaaaaattat tcataacttt caagagttcg agaactgctc atcttttcgc tcaagtcttg      1680
     atttctgata aatttaagga gctcaataat gtgataatag gaccaaaccc aattgacatg      1740
     atatggagta acgtaataca gtcaagcagg tggctgaaag tggttcgcat cattttcgct      1800
     gatctcatcg cagttttagt cattctcggt tgggttctgc cggtagcatt cgtcggcttg      1860
     atatcccaag tccccaacat gaaaatactg gtgccctttt ttacttggtt ggattctgat      1920
     aacgcctttt ttagcagcgt tttgtcaagc ttggttccta ttcttttcct tatttttctc      1980
     attgacattg ttccttttat ttttcgatgg cttagcatac taaaggtgaa caggactggt      2040
     gctgaaattg agttggatgt gcaaaggtgg ctgttcgttt ttttttttgt tcacattttc      2100
     ctcgttgtaa ctgtctcctc cggaatatcg gttatatttg aaaaactaat aaacaatcct      2160
     actagccttc cagatctgct agcagccaac ttgccaaaaa gttccaactt tttttattca      2220
     tttattttta tcagagggtt ggcttacttc ggtggaaatc tactgcaggt gaaagagctt      2280
     ctctttgagt tattttacta ccgttggtgc atcagaaccc ccagaaaagt tcggaaaaga      2340
     atggaggtag tctctgaaaa catgtggggc tcagtatatc ccttattttc aactattgcc      2400
     agtattggca tcgtttacag tgtgattgcg ccgttagtac tcattttcgc cacagttacg      2460
     tttcttatcg tccagttttc attcaagtgc cgcctgaatc atcagcaaca cagccgaggt      2520
     aagtctgaaa ctttcgggaa actttatcct caagcactga tgcagtcata tgcaggaatt      2580
     tactgcctcg aaatttgcat gatagggcta tttgcgcttt caaatcggta cgtgctagtg      2640
     atttgtatgg cattggtttt tatcttcaca attctagctc atttcaaaat ttcgaaattc      2700
     tatgacaagt acatcaactt tttaccgtta aaggaagatg aagaatcact gctcaccgag      2760
     cacccaagaa aagacctgtt cccctttttt gtgaaggaaa agtgcctctg gattccacaa      2820
     gattcatctg gggcttcgaa tgaccagtgc catttgatga acgaaaagtt tgatatcttc      2880
     tgccgcaatg aggggtgttt ttttgatggt gccactggca gcctcaattt tttgtag         2937
//

If you have problems or comments...

PBIL Back to PBIL home page