(data stored in ACNUC8465 zone)

EMBL: CU928166.PE126

CU928166.PE126       Location/Qualifiers
FT   CDS_pept        complement(253796..255139)
FT                   /locus_tag="KLTH0B03234g"
FT                   /old_locus_tag="KLTH-ORF15578"
FT                   /product="KLTH0B03234p"
FT                   /note="similar to uniprot|P41800 Saccharomyces cerevisiae
FT                   YLL006W MMM1 Mitochondrial outer membrane protein required
FT                   for normal mitochondrial morphology and mtDNA stability
FT                   involved in tethering mitochondria to the actin
FT                   cytoskeleton and in anchoring mtDNA nucleoids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21491"
FT                   /db_xref="GOA:C5DCI0"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="InterPro:IPR027537"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCI0"
FT                   /protein_id="CAR21491.1"
FT                   /translation="MKSPNETSFTNHTLENASTFGADLSIESNESLVSLDEYLSNTLPL
FT                   HLQQLFLENLQKRQQGILESASDSIIEAVRDSSQQKFQNGLHLSLDSGVGSKGSVFSAW
FT                   SFAQGLVIGQLSVIVVLIFFIKFFIFSEGPIKTEGPKGGKSGPKRDSAYVSPLLSTSTS
FT                   HFLSSIIKRGESDGADSSENTDTDRKFSQINTILEKTYYNVETHSPETLDWFNVLIGQT
FT                   IQQFREEALQKDNIVHSLNNFIARKSGELPQYLDTIKITELDIGEDFPILSNCRIQYSP
FT                   NSNKQRLEAKIDIDLSDRLALGIETKLLVNYPKPFTAALPIQLTVSIVRFQACLTVSLT
FT                   TAEEFVPTSENEASYGSENGGYFLMFSFSPEYRMEFDVKSLIGARSKLQDIPKIGSLIE
FT                   SQIKKWFVERCVEPRFQFIKLPSLWPRSKNTREEKTENDDISMKSTDL"
     atgaagtctc ccaacgaaac tagctttact aatcacaccc ttgaaaatgc atcaactttc        60
     ggggctgatc tctctattga atccaatgag tcccttgtat cgctcgatga atacttgagc       120
     aacactttac ctctacattt acaacagctt ttcctagaaa acttgcaaaa aaggcaacaa       180
     gggattcttg aaagcgcatc tgattcaata attgaggcag ttcgagactc gtctcaacag       240
     aagtttcaaa atgggctcca tctgtcgctt gattcagggg ttggctcaaa aggctcagtg       300
     ttctctgcat ggtcatttgc gcaaggactt gtcataggac aattaagtgt aatagtggtg       360
     ctcatttttt tcatcaagtt ctttattttc agtgaaggcc ccataaagac ggaaggtcct       420
     aaaggaggga agtcaggtcc aaaaagagac tctgcatacg tttcgccctt actatcaacc       480
     tcaacctctc attttttgtc atccatcata aaaagaggag aaagtgatgg tgctgattcc       540
     tccgaaaaca ctgataccga ccgcaagttt tcgcaaatca acacaatttt agagaaaaca       600
     tattacaatg ttgagacaca ttccccagag actttggatt ggttcaacgt cttaatcgga       660
     caaactattc aacaatttcg tgaagaagcc ttgcagaaag acaacattgt tcattcgctc       720
     aataatttta ttgcaaggaa gtctggagag ctgcctcaat atctcgacac aatcaagata       780
     acagaacttg acattggcga agatttccct attctatcca actgtcgcat ccaatattcg       840
     ccaaattcta acaagcagag actcgaggct aaaatagata ttgatctcag tgaccggctt       900
     gcactaggca ttgagaccaa gctattggtc aactatccaa aaccgtttac agccgctctt       960
     cccatccagc tcaccgtttc gattgtgcgt tttcaggcat gtttgaccgt ctctttgacg      1020
     actgcagagg aatttgttcc cacttcagaa aacgaagcat cgtatggttc ggaaaatggt      1080
     ggctactttt tgatgttttc tttttcacct gaataccgca tggaattcga tgtcaaatct      1140
     cttataggtg ccagatcgaa attgcaagat atacctaaga ttggcagctt aatagaatct      1200
     cagatcaaaa agtggttcgt tgagcggtgc gttgagccac gattccaatt cataaaacta      1260
     ccaagcttat ggccaagaag caaaaacacg agagaggaaa agacagagaa tgatgacatt      1320
     tcaatgaaat ctactgattt gtag                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page