(data stored in ACNUC8465 zone)

EMBL: CU928166.PE13

CU928166.PE13        Location/Qualifiers
FT   CDS_pept        complement(44522..46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /old_locus_tag="KLTH-ORF15941"
FT                   /product="KLTH0B00418p"
FT                   /note="highly similar to uniprot|P43550 Saccharomyces
FT                   cerevisiae YFL053W DAK2 Dihydroxyacetone kinase required
FT                   for detoxification of dihydroxyacetone (DHA) involved in
FT                   stress adaptation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21377"
FT                   /db_xref="GOA:C5DC67"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC67"
FT                   /protein_id="CAR21377.1"
FT                   /translation="MSQKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRAASAPSA
FT                   KNKPKVTLVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIFSALKAVESPKGT
FT                   LLIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKKGSLVGRRGLGATVLVH
FT                   KIAGAAASHGLELSEVAKIARAVVENSATIAGSLDHCTVPGHKPENNLGPDEYEIGMGI
FT                   HNESGTERRSPLPSIPQLVTELLPLVLGEKEDNTFVEFSPEEDVVLMINNMGGMSNLEL
FT                   GYATEVVSEQLIKKFSIVPKRTMSGTFITALNGPGFGITLLNASKAGPDIMRYFDYPTN
FT                   ASGWNQNYHSAQEWKVLAGGKVPTAPPLETVKNEKPSGVTANYETFSKILQSGIAKVKE
FT                   VEPKVTWYDTIAGDGDCGTTLVSGGRALEEAIQKHTLRLTDAAHGIEDIAYIVEDSMGG
FT                   TSGGLYSIYLSALAKGISDSGDKTLTVDTFREASKTALDALYKYTRARPGYRTLIDALQ
FT                   PFVEALNSGQDPRTAVDAAFKGAEKTRKMDALVGRASYVAKEELSKLDDEGGLPDPGAV
FT                   GLAALLDGLVSAAGY"
     atgtctcaaa aacaattcaa atcagacgga aatatcgttg cgccttacct actaggactt        60
     gctcgcagca atcccggtct caccgtgatc gaacatgaca gagtcgtatt cagggctgct       120
     tcagccccaa gcgctaaaaa caaacccaaa gtgacgttag tgtcgggagg cggcagtggt       180
     cacgagccta cgcacgctgg gtttgtaggc gatggtgcgc tcgatgcaat tgctgctggc       240
     gctatctttg cctctccctc cactaagcag attttttcgg cgctcaaagc tgtagagtcg       300
     ccaaagggca ccctgctgat tgttaaaaac tacactggcg atataattca ttttggcctt       360
     gctgccgaaa gagcaaaggc agcaggcatg aatgtggagc tcgtggcggt cggagacgat       420
     gtttcggttg gaaagaaaaa aggatctctc gttggtcgcc gtgggctagg cgcaaccgtt       480
     cttgttcata aaattgctgg cgccgctgct tctcacgggc tggagttatc agaagttgct       540
     aagattgcca gggcggttgt tgaaaatagt gctacaattg cgggatctct tgaccactgt       600
     acggtcccgg gccacaagcc tgaaaataac ttggggcctg atgaatatga aataggcatg       660
     ggaattcaca atgaatccgg caccgagaga cggtccccac tgccatcaat tccgcagctt       720
     gtaactgaac ttctacctct agttctagga gagaaggagg ataacacttt tgtcgagttt       780
     agccccgaag aagatgtggt tcttatgatc aacaatatgg gcggcatgtc caaccttgaa       840
     ttgggctacg ctaccgaagt tgtgtctgaa caactgatta agaaatttag tattgttccc       900
     aaaagaacaa tgagcggcac attcattacg gccttgaacg gtccagggtt cggcatcacg       960
     cttctgaacg catctaaagc cggccctgac atcatgaggt actttgatta ccccacaaat      1020
     gcaagcggat ggaatcaaaa ttatcattcg gcacaagagt ggaaagtgct tgccgggggc      1080
     aaagttccaa cagcgccccc tctagagaca gttaagaacg aaaaaccttc aggcgtgacg      1140
     gcaaattatg aaaccttctc caaaatactg cagtcaggga ttgcaaaggt gaaggaagtc      1200
     gaacccaaag ttacttggta tgacactatt gcaggtgatg gcgattgcgg cacaacgctc      1260
     gtttctggcg gcagggcctt agaggaagct attcagaaac acactttgcg tctcacggat      1320
     gccgcacacg gaattgaaga catcgcttac atcgtggaag actccatggg tggtacatcg      1380
     ggaggactgt actctatata cttgtcagca cttgcgaaag gtatcagcga ctccggagac      1440
     aagaccctta cagtagatac ttttagagaa gcatcaaaaa ctgctttgga tgcgctttat      1500
     aagtatactc gtgctcgccc tgggtacaga acactaattg atgcccttca gccttttgtt      1560
     gaggcgttga attcgggcca agatcctagg actgctgttg atgccgcttt caagggtgcc      1620
     gaaaaaacga gaaagatgga tgctctagta ggccgtgcgt cgtacgttgc aaaagaggaa      1680
     ttaagcaagc tcgatgatga aggaggatta ccagatccgg gcgccgtcgg gctggctgct      1740
     ttgttagatg gtcttgttag tgccgctgga tattaa                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page