(data stored in ACNUC8465 zone)

EMBL: CU928166.PE130

CU928166.PE130       Location/Qualifiers
FT   CDS_pept        complement(262380..268052)
FT                   /locus_tag="KLTH0B03322g"
FT                   /old_locus_tag="KLTH-ORF15567"
FT                   /product="KLTH0B03322p"
FT                   /note="similar to uniprot|P08678 Saccharomyces cerevisiae
FT                   YJL005W CYR1 Adenylate cyclase required for cAMP production
FT                   and cAMP-dependent protein kinase signaling involved in
FT                   cell cycle control and glucose and nitrogen repression of
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21495"
FT                   /db_xref="GOA:C5DCI4"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI4"
FT                   /protein_id="CAR21495.1"
FT                   /translation="MSEQTRRRANSLEAEKSFQVPEDAAEAGASGGLHGRPHFRKQYSV
FT                   GGFGPTFSGGASGASGGIAGAGSASAQGHGARGRAAKALGKGRYKGFHNPVALHSPDDP
FT                   IPPYAHPIKPRIPGLNRTISGNSLFSSSQAARDPQQLQHQQQQQQRKGSRAGSLFKRLT
FT                   GMKMTNASASEPSDQESAAANPTAGPAGIRRKMSTLIHGGSGAGSGQAQDAGHVSGSDL
FT                   NSKTSKSGFLNTPSSTNSRRGSAASIITSPSGNNSPKISHISNSNVNNALSATSASASA
FT                   NDSGNQVSDSSESPGRNALNRSTSYFLLDTDLNNLSDITNISDKKPKEKAKLPPKSRSQ
FT                   TPVAKVQPQDIGKAPLVDTETSAPHEAAHSKVQWIAPESWDIDEEVGKPLPGKKNKRRV
FT                   HRHHTSNTTSKIDRERAGGATKKPGRPKQKENTPKLGSLKEVTDQEHNHLSTTAQEDTK
FT                   ESSGSAASISSAASRSQEFSEAASSTSDYEDDYGDESHWRAGSLDSLQTYDSDQAKNDE
FT                   AFDRVGYELDKYYNDFSDIDPTRRYAIRVFNTDETFTTLSLTPNTTVQEMIPQLKRKFN
FT                   IGQGNYQVSLKVAKILKVLRPTARPILIQRKLLLLNGYQKGDPLHILGIEDLSYVFNFI
FT                   FHPVATSHLSYEEEQRLTRGDFIHVDLRSMNLTTPPIIFYQYTPNIESLDVSNNANIFL
FT                   PLDFIESASKLSSLRMVNIRASRFPPNITEAHVLVSLDLERNFIERIPPSISNLSELTI
FT                   LNLQCNELDRLPTGFTELKNLRLLDISSNNFAQYPEVINHCTNLLQVDLSYNKIQTLPD
FT                   SINRLTKLAKMNLSNNKLTNIGSLSGMVNLRTLNLKDNRITSLKLENSNLQNLSISNNR
FT                   ISVFDDKLPKLKSLEIHENPITSISYDGEYLVNIVTLSLNKAKLASLPPELLCKLPRLE
FT                   KLELNGNNLTQIPPEISKLTKLVYLSAARNKLESISEDITELRNLKTLDIHSNNLSNLV
FT                   KGLGKMELINFNVSSNLLGNTMDIQEVFLNRRDSVLAKSLRFLSMADNNLGDQFWTLFN
FT                   MYENLKTLNLSYNNLSDLSNFKLENLTELYLSGNKFITLQGDTVLRWKSLKVLMLNGNN
FT                   LLSLPSELSQLTQLNVLDVGSNQLKYNISNYHYDWNWNNNKNLKYLNFSGNKRFEIKST
FT                   AALDSESKADLSDLTILKELRILGLMDVTLKTSKVPDEGVNMRLRTTASVLNGMKYGVA
FT                   DTLGLKDSVTSRDVTFERFRGKEDECLVCLFDGKNENVSTGHNISKIIRDIYHKILIRQ
FT                   LEKYGDTAEGIKNALRFSFLQLNKEINSTLNSVDNEATSEDFSSADLLSGSSATVLYMK
FT                   GKRLYTANIGDTMAILSKNNGDVVPLTKLHVPSKREEYERIRISGGYVNNYKLDGVSDV
FT                   SRAVGFFDLLPHIHASPDLSEFNLTTTDDLVIIATAKLWDYLDYQTACDICRENKVEPM
FT                   LAAEKLKDYAISFGCAANMTILCISLDKSSSNQNNFMLNKNDLISRRSTFEDSTLRRLQ
FT                   PEISPPTGNLAMVFTDIKNSTFLWESFPNAMRSAIKTHNDIMRRNLRIFGGYEVKTEGD
FT                   AFMVAFPTPISALVWCMSVQLKLLEAEWPEEITSIQGGCLITDNEDRKIYLGLSVRMGI
FT                   HWGCPVPELDVVTQRMDYLGPVVNKASRVSGIADGGQITLSSDFCSEFNKILGLHERVV
FT                   KENAPLKEVYGEEFVGEIMEREVHLLESIGWEFRELGEKKLKGLETKEFITIAYPKALE
FT                   ARHGFTTRDAETSLVDEETLFQLRAVSTKLESLVSVLNGVMLEKKEYSEAGSYVNLDKK
FT                   QISAVSHSTTEGDRIALLDHIITRLESIVATLQIRQRVEGALEPPKIGDAGGERSIFEI
FT                   VDQLLLETGRLTDSRK"
     atgagcgagc aaacccgtcg acgtgccaat tcgctagagg cggagaagag cttccaagtg        60
     ccggaggacg cggccgaggc aggcgccagc gggggtttac acggtagacc acatttccgg       120
     aaacagtatt cagttggggg ctttggtcca acgtttagcg gcggcgcgag cggcgcgagc       180
     ggcggaattg cgggcgctgg gagcgccagc gcacagggac atggcgcgcg cgggcgcgct       240
     gccaaggcgc tgggcaaggg tcgctataaa ggtttccaca acccagtagc actacactcg       300
     ccagacgacc cgattccgcc ctatgcgcac ccgatcaagc cccgtatccc agggctgaat       360
     cgcactataa gcggcaactc gcttttctct tcgtcgcagg cagcacggga cccacaacag       420
     ctgcagcacc aacagcagca gcagcaacgg aaaggttctc gtgccgggtc gttgttcaag       480
     cggctgacag gtatgaagat gactaacgca agtgcctcgg agccttcgga tcaggagtcc       540
     gccgcagcga atcccacggc aggtcctgcg ggtattcggc gtaaaatgag tacacttatt       600
     cacgggggga gcggtgcggg gtccggccag gcccaagacg ctggccacgt ctcaggctcc       660
     gacctcaaca gcaaaacgag taaaagtggt tttttgaata ccccgtcatc cacgaacagt       720
     aggcgcgggt cggctgctag catcataaca tccccgagcg gcaacaattc accaaagatc       780
     agccatatca gtaatagtaa tgtcaataac gcactcagtg ccacaagcgc tagcgctagc       840
     gcaaatgaca gcggcaacca ggtttctgac tcctccgaga gtccgggccg caatgccctt       900
     aacagaagca ctagctactt tctgctggac acagacttga acaatctttc tgatatcacg       960
     aatatttcag acaaaaagcc taaagaaaaa gccaagcttc cccccaaatc caggtctcag      1020
     accccagtag caaaagttca acctcaggat attggaaagg cgcccctggt tgatactgaa      1080
     acgagtgcgc cccacgaggc agcgcactca aaggtccaat ggatcgcccc cgagagttgg      1140
     gacatagatg aagaagttgg aaagccactg ccgggcaaaa aaaacaagcg gagagttcac      1200
     cgccatcaca caagcaacac gacttcaaaa atcgaccgag agagagctgg cggtgccacc      1260
     aaaaagcctg gccgacctaa gcaaaaggaa aacactccaa aacttggatc gctgaaagag      1320
     gttactgacc aagagcacaa tcacttgagt actactgccc aagaagatac taaagaatct      1380
     tcagggtcgg cagctagcat aagcagtgct gcaagtagat ctcaagagtt tagtgaggcc      1440
     gcatcttcga ctagtgacta tgaagacgat tacggtgatg aaagtcattg gcgcgcaggt      1500
     tctttagact ctttgcagac atacgattca gatcaagcta agaacgatga agcattcgat      1560
     agagtgggtt atgagcttga caagtactac aacgacttta gcgacataga tcccacgaga      1620
     cgatacgcaa tcagagtttt caacaccgat gaaaccttca ctaccctatc actgacgcct      1680
     aataccaccg tacaggagat gatacctcag ttaaagcgta aatttaacat tggccagggc      1740
     aactaccaag tctccctaaa agttgccaaa attttgaaag tccttagacc gactgcgcgt      1800
     ccgattctca tccaacggaa gcttttacta ctcaacggtt atcagaaagg agaccctctg      1860
     cacattttag gtattgagga cttgagctat gtcttcaatt tcattttcca ccctgttgcc      1920
     acttctcatt tgagctacga ggaggaacag agactaacca gaggagattt cattcatgtt      1980
     gatttacgaa gtatgaatct gacaacccca ccaatcatat tttaccagta tactcctaat      2040
     attgagagcc ttgatgtttc aaacaacgca aacatctttc tgcctcttga ttttattgaa      2100
     agtgcttcga agctgtcaag tttaagaatg gtcaatatca gggcttcaag atttcccccc      2160
     aacatcacag aagctcatgt tctagtttcg cttgacttgg agaggaattt cattgagcga      2220
     atcccgcctt caatatccaa ccttagtgag ctcactatcc tgaacttaca gtgcaatgaa      2280
     ttagataggc ttcctacagg attcactgaa ctaaaaaact tgcgactact agatatttcc      2340
     tcgaacaact tcgcacaata tcccgaggtc ataaaccatt gcactaattt acttcaagtc      2400
     gacctctcat acaataaaat tcaaaccttg cctgattcca tcaaccggtt gactaaacta      2460
     gcaaaaatga acttgtcgaa caacaaactc acgaatatcg ggagcttatc tggaatggtt      2520
     aacttgcgaa ccttaaattt gaaggacaac cgtatcacat ctcttaagtt agagaattct      2580
     aatttgcaga acctatccat ctcgaataac cgtattagcg tctttgatga caagttgccc      2640
     aaacttaaat cattggaaat tcatgagaac cctattactt caatttctta tgacggggaa      2700
     tatctcgtta acatagtgac gctttcgctc aacaaggcaa aacttgccag tctgcctcca      2760
     gaattgttat gcaagctacc tcgtttggaa aaacttgagc tgaatggaaa caacttgacc      2820
     cagattcctc cagaaatcag taagttgaca aagttggtct acctttcagc agcgcgaaac      2880
     aagcttgaaa gcatatcaga agatataaca gagctcagga atctgaagac tcttgatatt      2940
     cattccaata acctcagtaa tctggtaaaa gggctaggca aaatggaact gatcaatttc      3000
     aacgtctctt cgaacttgtt gggcaatacc atggatattc aagaagtctt cttgaacaga      3060
     cgtgactccg tgttggcgaa aagtttaagg tttctgagta tggcggataa taacctagga      3120
     gatcaatttt ggacgctttt caacatgtat gagaatctga aaaccttgaa tctttcatat      3180
     aataatctca gtgacctctc caatttcaag ctagaaaact tgactgaact ttatctgtct      3240
     ggaaacaaat ttattacatt gcagggtgat actgttctta ggtggaagtc cctaaaagtg      3300
     cttatgttaa atggcaacaa cctgctttct ctgccatctg aattatctca actcacccag      3360
     cttaacgtac tggatgtcgg ttcaaatcag ctcaagtaca acatctcgaa ctatcactac      3420
     gattggaact ggaacaataa taaaaatctg aagtatctta acttctcggg caacaaaagg      3480
     tttgaaatca agtctacagc cgcactagat tctgagtcca aagctgactt gtctgatttg      3540
     acaatattga aggagctaag aattttgggg ttgatggatg tcaccttgaa aacgtcaaag      3600
     gttcctgacg agggggtcaa tatgcgtctt agaacaacag catctgtatt gaatggtatg      3660
     aaatatggtg tggcagacac attgggactt aaagattcgg taacatccag ggatgttaca      3720
     ttcgagagat ttaggggcaa agaggacgag tgtttggtct gtcttttcga cgggaaaaat      3780
     gaaaatgtca gtaccgggca taacatatcc aaaatcatta gggacatata ccacaaaatc      3840
     ttgattcgcc aactggagaa gtacggagat accgccgagg gaatcaagaa tgctctgcgt      3900
     ttcagtttct tgcagttgaa caaagagatt aacagcacac taaattcagt tgacaatgag      3960
     gcaactagtg aggatttttc gtccgcagac ctactgagtg gctcttcagc tactgtgttg      4020
     tatatgaagg gtaaaaggct atacactgca aacattggag atacgatggc cattttgtcc      4080
     aagaacaatg gtgacgttgt gccactcacg aagctccacg ttccatcaaa acgagaggag      4140
     tatgaaagaa tacgtatatc cggtggttat gtgaacaatt acaaacttga cggcgtatct      4200
     gacgtttcaa gagcagttgg gtttttcgac ttactacctc acattcatgc atcgcccgac      4260
     ttgtcggagt ttaatttaac taccaccgat gacttagtga ttatcgcgac tgccaagctg      4320
     tgggactatc tagattacca gacggcctgt gacatttgca gagaaaataa ggttgagccc      4380
     atgttagcag cagaaaagct gaaagactac gcaatatcat ttgggtgtgc agcaaatatg      4440
     actattttat gcatatctct ggataaatcc tcatcaaatc aaaataactt tatgctgaac      4500
     aaaaacgatc taatttctcg gagaagcacc tttgaagatt caacattaag aaggctacaa      4560
     ccagaaattt ctcctcctac tggtaaccta gccatggtct tcacggatat caaaaactcc      4620
     acttttcttt gggaatcgtt tcctaacgca atgaggagtg cgataaagac tcataacgac      4680
     atcatgagac gcaacctccg cattttcgga ggctatgagg taaaaactga aggtgatgct      4740
     tttatggtag catttccaac ccccatcagc gcccttgttt ggtgtatgag tgttcagctg      4800
     aagctgctag aggcagagtg gccagaagaa atcacttcta ttcaaggtgg ttgtttgata      4860
     accgacaatg aggatcgcaa aatatacctg ggtttgagtg ttaggatggg aatccattgg      4920
     ggctgcccag tgccagaact tgatgttgtc acgcaacgta tggattattt aggacctgtg      4980
     gtgaacaaag catcaagggt ttcaggaatc gctgacggtg gccaaatcac tctcagcagt      5040
     gacttttgct ctgagttcaa taaaatactg ggtcttcacg agcgtgtggt caaagagaac      5100
     gcgccgctga aggaggttta tggggaagag tttgttggtg aaatcatgga aagggaggtt      5160
     catcttttag aaagcatcgg atgggagttc cgagagcttg gagagaaaaa gttaaaggga      5220
     ctagagacca aagaattcat caccatagca tatccaaagg cactagaagc tcgccacggt      5280
     tttactacaa gggacgccga gactagtctt gttgatgagg aaactctgtt ccaattaaga      5340
     gctgtttcta ccaagttgga aagccttgtg tctgtcctga atggtgttat gcttgaaaag      5400
     aaggagtata gcgaagctgg cagctatgtg aacttagaca aaaagcaaat ttccgccgtt      5460
     tcacattcaa ccacagaagg agaccgcata gctttgttag accacattat aacaaggttg      5520
     gagtctattg tagcaaccct acagatacgg cagagggttg agggggccct cgagccacca      5580
     aagataggag atgcaggcgg ggaaagatca attttcgaga tcgtggacca gctcctcctg      5640
     gagacaggac gtctgacgga tagtagaaag tag                                   5673
//

If you have problems or comments...

PBIL Back to PBIL home page