(data stored in ACNUC8465 zone)

EMBL: CU928166.PE132

CU928166.PE132       Location/Qualifiers
FT   CDS_pept        complement(271449..272618)
FT                   /locus_tag="KLTH0B03366g"
FT                   /old_locus_tag="KLTH-ORF15558"
FT                   /product="KLTH0B03366p"
FT                   /note="weakly similar to uniprot|Q7LGY6 Saccharomyces
FT                   cerevisiae YLR018C POM34 nuclear pore integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21497"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI6"
FT                   /protein_id="CAR21497.1"
FT                   /translation="MSNSAMDNSFEPSSSNSAFSALYRRDFGNAMNSSTVPRKMFSTPV
FT                   KPVTQERFASVREKVVRESPYLYKSKILSSPVKDGKRVSKSVGGTPLARPTVFQKSRPT
FT                   SSESTSNETEAKGTVASENTESVLGGFENPVLAQYSCRIVNKELETRKIISNLLAVLVW
FT                   NLALKFLSLYLDHTLHGAGFSKRVAKWVQETLVYRINPYADFEHSRWARLITLANVSHI
FT                   FHLIIFYNVTVSLWRLLVKSQNVKIDDLHLNQRQKQLLGLSDQTQTSSALPRVVLAASP
FT                   QEPLSKPTSLASSPHKASAPPVFLFKSLQTPLKSKERAAAAERAGVRSERAPKINAFGD
FT                   LRSSVLKKSSLTPSHVSSGLLPTAMNRTGYIPSSKYAYMRDSPSPRKTM"
     atgtcgaatt cagcgatgga caatagtttt gagcctagtt catcaaattc agccttttcg        60
     gcactgtatc gaagagattt tggaaacgcg atgaattcat caaccgtacc acgcaaaatg       120
     ttctcaacgc cagtgaaacc ggtgacgcag gagcgcttcg ccagtgtgag ggaaaaagtg       180
     gtgagggaat cgccctattt gtacaaaagc aagatactat caagcccagt caaggacgga       240
     aagcgagtct ccaaaagcgt gggcggaacg cctcttgcaa ggcctacagt gttccaaaaa       300
     tccagaccca caagctcaga atcaacttcg aacgaaacag aagctaaggg aacagtagca       360
     tctgagaaca cggagagcgt cttggggggg ttcgaaaacc ccgtgcttgc tcaatattca       420
     tgcaggatcg ttaacaaaga gctcgagacc cgcaaaataa tttcaaattt acttgctgtg       480
     cttgtttgga atctggcgtt gaagtttcta agcttgtacc tcgaccatac cttacatgga       540
     gctggtttca gcaagcgggt cgcaaaatgg gtgcaagaaa ctttagtgta tcgtattaat       600
     ccatatgcag atttcgagca ctcaagatgg gcgcggctaa tcacacttgc caatgtttct       660
     catatattcc atctgattat cttctacaat gttactgtct cattgtggag gctccttgtc       720
     aaatcccaga atgtcaagat tgatgacctg cacttgaacc agcgccagaa acagctgctc       780
     ggcctttcag atcagacaca aacttccagc gctctaccgc gcgtcgtgct tgcagccagt       840
     cctcaagaac ctttgtcaaa gccaactagc ttggcttcaa gccctcacaa agcttcagcg       900
     ccgccagttt ttctattcaa gtcgctacaa acgcctctaa aatctaaaga acgtgccgcc       960
     gctgcggaac gcgctggcgt aagaagtgaa cgtgcaccca aaataaatgc ttttggtgac      1020
     ctgcgatctt ctgttttgaa aaagtcgagc ctgacgcctt ctcatgttag tagtggactg      1080
     ttaccgaccg caatgaatcg cacgggctat attcctagca gtaaatatgc atatatgcgc      1140
     gactcaccga gcccaaggaa aacgatgtag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page