(data stored in ACNUC8465 zone)

EMBL: CU928166.PE137

CU928166.PE137       Location/Qualifiers
FT   CDS_pept        complement(279956..280684)
FT                   /locus_tag="KLTH0B03476g"
FT                   /old_locus_tag="KLTH-ORF15547"
FT                   /product="KLTH0B03476p"
FT                   /note="highly similar to uniprot|Q07953 Saccharomyces
FT                   cerevisiae YLR022C SDO1 Protein required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21502"
FT                   /db_xref="GOA:C5DCJ1"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ1"
FT                   /protein_id="CAR21502.1"
FT                   /translation="MINQPSGQIKLTNVSIVKLKKGKKKFEIACYQNKVQDFRKGVEKD
FT                   VDEVLQIHQVFINVSKGQVASKEDLTKSFEAKDLDTIIKEILTRGEIQLSEKERQLMLN
FT                   KINNEMLTIVSAKCINPKSKKRYPPTMIHKALVELKFNVVLNKPAKLQALEAIKVLVAK
FT                   QIIPIVRARMRIKVDLQKPGNDDLIEKLLPLIKSPELTEAESSWCCAGLIDPVSYRTIV
FT                   EACNNRGTLQVLDMAVVDNK"
     atgataaacc aaccttctgg acaaatcaaa ctgacaaatg tgtctatcgt aaaacttaaa        60
     aaaggcaaga agaagtttga gatcgcctgc taccagaaca aagtacagga cttccggaaa       120
     ggcgttgaga aggacgttga tgaagttttg cagattcatc aagtcttcat caacgtttcc       180
     aagggccagg ttgcctcgaa agaggaccta acaaagtcgt ttgaggcaaa agacttagac       240
     accataatta aagaaatcct cacaaggggt gaaatacagt tatcggagaa agagcggcag       300
     ctgatgctga ataagattaa caatgaaatg cttacaattg tcagcgctaa gtgcattaac       360
     cctaaatcaa aaaagcgcta ccctccaact atgattcaca aggcgttggt tgagttaaag       420
     ttcaacgttg tgctcaacaa accagcgaaa ttgcaggccc tggaggccat taaggttcta       480
     gttgccaaac aaataatccc aatcgtccgc gcaaggatga gaatcaaggt cgacctacag       540
     aagccgggca acgatgacct aattgagaag ctactgcctc tcatcaaatc tccagagctg       600
     acagaggctg aatcctcatg gtgctgtgct ggtctaatag atcccgtgtc atatcgtaca       660
     attgtagagg cttgtaataa caggggcact cttcaagttc tggacatggc cgtagttgac       720
     aataagtaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page