(data stored in ACNUC8465 zone)

EMBL: CU928166.PE139

CU928166.PE139       Location/Qualifiers
FT   CDS_pept        284167..286437
FT                   /locus_tag="KLTH0B03520g"
FT                   /old_locus_tag="KLTH-ORF15535"
FT                   /product="KLTH0B03520p"
FT                   /note="some similarities with uniprot|Q02601 Saccharomyces
FT                   cerevisiae YLL013C PUF3 member of the PUF protein family
FT                   which is named for the founding members PUmilio and Fbf"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21504"
FT                   /db_xref="GOA:C5DCJ3"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ3"
FT                   /protein_id="CAR21504.1"
FT                   /translation="MSTTENQRDPWVTHDAAGSAGGAHAANMDSELASIVSSLSALSSV
FT                   SAHQQHGQIGSFRRGSFHSNQGSDVESEMLFHTQTSPPIKRTTLSVGGMPLGGPSGVNN
FT                   RLSKMKNYSGSLAGGSVLQQQPIQGGFFERFGRSLAEGTREVELNLGSTSGRASRRESM
FT                   NAMDSLSRATTNSTFQGVAMEGRRTSVASDAMESLSENLNMQPEEPGNLNHRNIWKVAE
FT                   APVFRPQASENSGMEPAFPQPPAEALNQPYGFSYPNYWKMGAPMIPLAVPPSEQLKAGK
FT                   DFPEPSAAGGNVPVDPSSQPFPPFMFPNNPYLFFPPGATPPPPPHPFQPAASNPKDLPK
FT                   GPNAKTHGNPYLYNSRNHKPARGSPSAPFPPQPNPAAAANSSTPRGKGKYNVVRSPLLE
FT                   EFRNNSSGKEYRLPDIYGSALEFCKDQHGSRFIQQELVKATDTEKEVIFNEIRDEAINL
FT                   ADDVFGNYVIQKYFEHGLKSQKDVLFEKFTGKMEKLSLQMYACRVIQRALECIDLDQKV
FT                   ILVNELSGCVLKMIKDQNGNHVIQKAIERIPIEKLPFILGSLEGQIYHLSTHSYGCRVV
FT                   QRLLEYGTLEDQEKILADLDQFIPFLIQDQYGNYVIQHILKQGPETDDTHIGRTKQNIV
FT                   DIVCKNVVEYSKHKFASNVVEKTMVFGSPAQKKQFMEKVLPESAEHATRLEDNAPLILM
FT                   MRDQYANYVVQKLVGVAEGDDKKVTVIAIRSYLEKLNKINALGNRHLASVEKLAAIVEN
FT                   VQV"
     atgtctacga ctgagaatca gcgcgacccg tgggtgaccc atgacgccgc gggcagcgcc        60
     ggcggcgcgc acgcggccaa catggactct gagctcgcgt ccatcgtctc ctcgctctcg       120
     gcgctctcca gcgtctccgc gcaccaacag catggccaga tcggcagctt ccggcgcggc       180
     tccttccaca gcaaccaggg aagcgacgtt gaatctgaga tgctttttca cacgcagacc       240
     tcgcctccca tcaagcgcac aacgctttct gtcggcggta tgccactcgg cgggccctct       300
     ggcgtcaaca accgcctgtc gaagatgaag aactattccg gaagcctcgc gggcggaagt       360
     gtcttgcagc agcagccgat acagggcggc ttcttcgaac ggttcggccg ctcgcttgcc       420
     gagggcacgc gggaggtcga actcaacctg ggcagcacgt ccggcagagc ttcacgccga       480
     gagagtatga acgccatgga ctcgctttcg cgcgccacca cgaactcaac cttccagggc       540
     gttgctatgg aagggaggag aacgtcggtg gcttccgatg ccatggaatc tctcagcgaa       600
     aacctgaaca tgcagcccga agagcctggc aatttgaacc atcgcaacat ctggaaggtc       660
     gccgaggccc cggtcttcag accccaagct tccgaaaact ctggcatgga gcctgcgttc       720
     ccacagccgc ccgccgaggc tctaaaccaa ccttatggat tctcgtaccc caactactgg       780
     aaaatgggcg cacctatgat tccactcgca gtgcccccct cggagcagct caaggcgggc       840
     aaagactttc ccgagccttc tgctgcgggc ggcaatgtcc cggtcgatcc ctcgtcgcaa       900
     ccctttcctc cattcatgtt ccccaacaac ccttacctgt tttttcctcc aggcgccact       960
     ccgccaccgc caccacatcc ctttcagcct gctgcgagca accctaaaga cttgccaaaa      1020
     ggtccaaatg ccaagactca tggaaaccct tacttgtaca actcgcgaaa ccacaaacct      1080
     gcccgtggga gtcccagcgc accgttccct ccacagccta atccggcggc ggcggcaaac      1140
     tccagcacgc ctcgtggaaa gggcaaatac aacgttgtga ggtcacccct tctagaagaa      1200
     ttccgcaaca attcgtctgg aaaagagtac aggcttccag atatctatgg ttcggcattg      1260
     gaattttgta aagaccagca tggctcaagg tttattcagc aagagctagt gaaggccacc      1320
     gatacggaaa aagaagtgat tttcaatgaa atccgagacg aagccataaa cctggcagat      1380
     gatgtcttcg gaaactatgt tattcagaaa tattttgagc acggtttgaa gtcccaaaag      1440
     gatgttcttt ttgaaaaatt cactggcaag atggagaaat tgtcccttca gatgtatgca      1500
     tgccgtgtga tacaaagagc tctcgaatgc atcgaccttg accaaaaagt cattcttgtg      1560
     aatgagcttt ccggatgtgt gttgaaaatg ataaaagatc agaacgggaa ccacgttatc      1620
     caaaaggcga tcgaacgcat tccaattgag aagctgcctt tcatattagg gagcctagag      1680
     ggtcagattt atcatttatc tacacattcc tatgggtgca gggtggtcca gaggcttttg      1740
     gaatatggca cgcttgaaga tcaagaaaaa atactagctg atcttgacca attcataccg      1800
     ttcttgatcc aggaccagta cggtaactac gtgatccagc acattttgaa gcaggggccc      1860
     gagactgatg atacacatat tgggagaact aaacagaaca ttgttgacat cgtttgcaaa      1920
     aatgttgtgg agtactcgaa gcacaaattc gcttctaacg ttgttgaaaa aaccatggtc      1980
     tttggctcac ctgcgcaaaa gaagcagttt atggaaaagg tgctgccgga aagtgcagag      2040
     catgccactc gcttggaaga caatgctccc ctgatcttaa tgatgcgcga ccagtacgcc      2100
     aactacgtag ttcaaaaact ggtaggggtt gccgagggag atgacaaaaa agtcacagtc      2160
     attgctatcc gttcgtacct cgagaagctg aacaagatca atgctcttgg aaaccgtcat      2220
     ttggcttctg tcgagaaatt agctgcaatt gtggaaaatg ttcaagtcta a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page