(data stored in SCRATCH zone)

EMBL: CU928166.PE144

CU928166.PE144       Location/Qualifiers
FT   CDS_pept        complement(292423..297858)
FT                   /locus_tag="KLTH0B03630g"
FT                   /old_locus_tag="KLTH-ORF15516"
FT                   /product="KLTH0B03630p"
FT                   /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
FT                   YLR024C UBR2 Cytoplasmic ubiquitin-protein ligase (E3)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21509"
FT                   /db_xref="GOA:C5DCJ8"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ8"
FT                   /protein_id="CAR21509.1"
FT                   /translation="MTPEVNSLREFLVSLPRLASYKYNPSIEYLLWKTLDECVKDGLSS
FT                   VNWLEKEQFFASQNWENGAYQALRLPENWRDSFFSTAAKSGLNHAGSSCNRLCSPTETV
FT                   FYCFDCTRNPLYEICERCFDAQKHKGHRFTSRVVTRPEGRACHCGDPSGFNSGTNELLC
FT                   KNEANNQVRSPNYNYDANLTSIFEQILDYLIDTIIFLKELYEEPNKTVMSDGKGCPETT
FT                   STTCALQLYESDCSLHIKDLAYRISLLLNKPIEFGLMMVDKLQRDCSFITLFECADTKK
FT                   LAIIQDAFASENITLHVKATSNVFKEYLIDEIINWLYKLCLYSPSLTSKLSLRLALSGA
FT                   WNSGLLSTKHTPHDFSPFTSKIALLGGFVVPFEQRETFPWPKPWGFPFESDARHDPRIL
FT                   QVMHEYDKRLQETNSSGVTTRFTSILGSRLQTILVEEAALLPKIARFRILKIVSSIFTI
FT                   TDDSRKCIAAQYIDVYPNLLYNAVACDSFSQKVSLMSSLSQHIFQVPEIANMIISSGFI
FT                   ERIIQFAFTLMSFSPEELTECPPVPLYGDFKLPTDMIKNKRSVVCFKDIYLLMSTNTQP
FT                   EMLLTNDSITQCMIRCFSAFNNVLPLRRETAEHVEFENFEFSSYFFYFSSILVMVDGFI
FT                   RNICLLEDPHARGRVVRHFLKLSLSKEFELLGNAKSLMPGKLSTSCELKTSNGLRVIRE
FT                   KVCNTISSVIQFQVGIDCQSFFNPMSYFFKFVTLWSQCGRYEPLPYNFSDFFDIREVFG
FT                   DKIQMNWMCESALSTIVLLAQINVGFWVRNGSPIQHQARMYTRYSMREFTYFSDIFMLQ
FT                   LAMSIADPNEFMVTFLSRWGLKNWAEGIPIGDYPDAEITAGMVDQLLLLLIQLFSEIRS
FT                   LTMKSSVEGFEKTMQMEISHALCFKNSTHSEILNLIPEHVTKHPAFDLYLREMADYAPP
FT                   NGPVDAGIYTLKEKYFSLIDPYFIGFSPSKRFEAEKLIRKRLSIETQTDYNMSYIPARD
FT                   FASCLKETPYKNLYQICSTEIFGCFLKNTLDHINKFNYESMLTKATHLVHLCVVNDLLG
FT                   FTSIFWKEYGFSNSEYLYNSSIGSLLYSFLFKEEFVNEHGKIREIFQHFMKYAPHVNIE
FT                   GYLTEQTPSFNFEILKTPFKTTERKDEEYEKRKQLAKHKREKIMKRIAKQQQKFLANNH
FT                   ISLEDESGSLCKNRDQGENQFFPEMTCVFCKMHKVNDTFIYFAYLERNICEAEVELDWE
FT                   LSHARVSAIPKEGGRSHSNEAARDMDIVEMPQSLSSKISVFPVLRTCGHGSHVCCLTSH
FT                   MKSTRTVHNHITKNIPSSLGFSLMFCPLCSALTNCFLPRMCGDSSGSAPNPSEPIERND
FT                   PFESSLKNCNRSVAVLRELVQMDGVGESPIQVLNYIYRNTLRNTELATRLKRPHRETVK
FT                   ECSDFASHQQLLTLRLLSDLRRIYSQFSEPKEYVSPKEYSLFPPPFKYTPNQKSTKQEC
FT                   ELDLLNLADYRILNTDFGSKVCVKEFLLEFINKGLHQDFLAICGSIATKGSREVTACKH
FT                   QLQKKTSFTSSEEKHVFCILRSYLSNFSTADLTAVELATSITRGVLKDSMVIRLRRLFA
FT                   LLYFGGTPEFELKERIIDFGVLGDLLKGFDLPDFSELLQNYIDRDLQQMLKHVELTLKE
FT                   QGEEELIKNANALKIGCFKKNFLINLPQSYSEFMSNEDEFLQMRAKKQEIAICLFCGSR
FT                   VRVQNAVLLHNYSIGECTNHSLNVCRVNPIYGCFLLVRSNTVYLSYGHRGTFYQAPYLN
FT                   SHGETDDDYRNGAPVFLDRNRYLHLSQDVILNNMVPHLVFRLTENTLDLGGWESL"
     atgacccctg aagtcaactc tcttcgagaa tttttggtat ctcttccgag attagccagc        60
     tacaaatata accccagtat tgaatacctg ttatggaaga cgcttgatga atgtgtaaag       120
     gatggactta gttcggtgaa ttggctagaa aaagaacagt tcttcgcatc tcaaaattgg       180
     gagaatggag cttaccaagc cttgaggctg ccagaaaatt ggagggactc cttttttagc       240
     actgcagcaa agagtgggtt aaaccacgct ggatcaagtt gcaataggct ttgtagccca       300
     actgagactg tattctattg ctttgactgc accagaaacc cattatatga gatttgcgag       360
     cgatgctttg acgctcagaa gcacaagggc caccggttta cctcacgcgt cgtcactagg       420
     ccagaaggtc gagcctgcca ttgtggcgac ccgagtggct tcaatagtgg cactaacgag       480
     cttctgtgca aaaacgaagc aaataatcaa gtgcgctcac ccaattacaa ctacgatgca       540
     aacttgacca gcatatttga gcagattctc gactatctga ttgacaccat catctttttg       600
     aaagaactct atgaagaacc taacaaaaca gttatgtcag atggaaaggg ttgccccgag       660
     accactagca ccacatgtgc tctacaactt tacgaaagtg attgctcgct gcatataaag       720
     gaccttgctt accgcattag cttgctactc aacaagccca ttgagtttgg cttaatgatg       780
     gttgataaac ttcaacgaga ttgttctttc atcacccttt tcgaatgtgc cgataccaaa       840
     aagttagcaa taatacaaga tgcgttcgca tctgagaata taaccttgca tgttaaagcc       900
     actagtaacg ttttcaaaga gtatttgata gacgaaatta taaactggct ttacaaactg       960
     tgtctttaca gcccctcact tacctcaaag ttatctttac ggttggccct atctggtgct      1020
     tggaactctg gccttttatc aacgaaacat acacctcatg atttcagccc ttttacttcc      1080
     aaaattgcac tcctgggtgg ctttgttgtg ccatttgaac agcgggaaac attcccatgg      1140
     cctaagcctt ggggttttcc ttttgaaagt gatgctcgtc atgaccctag aattcttcaa      1200
     gtaatgcacg aatatgacaa aagattacag gagacaaact ccagcggtgt cactactagg      1260
     tttacttcta tcttaggttc taggcttcaa acaatattgg ttgaagaagc tgcattatta      1320
     cctaagattg caagatttcg aatactcaag atcgtcagca gcatcttcac tataacagat      1380
     gactcgcgaa aatgcatcgc agcacagtac attgatgtgt accccaatct gctttacaat      1440
     gcagtggcat gtgactcctt tagtcagaaa gtctctttga tgagctcctt atcacagcat      1500
     atatttcaag tgccggaaat agccaacatg atcatatcat cgggatttat cgaaagaatc      1560
     atccagttcg cctttacatt gatgtcattt tcccctgaag aattgacaga gtgccccccg      1620
     gtgccactat atggtgattt caaactacca accgatatga taaaaaataa acgcagcgta      1680
     gtttgcttca aggatattta tctcctgatg tccacaaaca ctcaaccgga aatgctctta      1740
     acaaatgatt caattaccca atgcatgatt cgttgttttt cagctttcaa taacgtcttg      1800
     cctttgagac gtgagaccgc agagcatgtg gaattcgaga atttcgaatt ttcctcttac      1860
     ttcttttact tttcatccat tcttgtcatg gtggatggct tcataagaaa tatctgccta      1920
     cttgaagatc ctcacgcccg gggaagagtg gtgcgccact tcctgaaatt gtcattgtca      1980
     aaagaatttg agttacttgg gaacgccaaa tctcttatgc ccggcaaact gtcaacatct      2040
     tgtgaactta agacaagcaa tggtctacgt gtgatcagag aaaaagtctg caatacgatc      2100
     tcgagcgtca tccagtttca ggtcggcatt gattgtcaaa gcttcttcaa cccaatgtca      2160
     tactttttta agttcgtgac actttggagt cagtgtggaa gatatgagcc tctcccatac      2220
     aattttagcg atttcttcga tataagggag gtttttggtg ataagattca aatgaattgg      2280
     atgtgtgagt ctgctctgtc aaccatcgtt ttgttggctc agattaatgt tggattttgg      2340
     gttaggaatg gctcacccat tcagcatcaa gcaaggatgt acacaaggta cagcatgaga      2400
     gagttcacat actttagtga catatttatg cttcagttag cgatgagtat cgccgatcca      2460
     aatgagttta tggtaacctt tttatccaga tggggactga agaattgggc tgaaggcatt      2520
     ccaattggag attatcctga tgctgaaatt acggcgggaa tggtagacca gttgttgctt      2580
     cttctgatcc agcttttcag cgagataaga agccttacaa tgaaatcttc agttgaaggt      2640
     tttgaaaaga caatgcagat ggagattagc catgcattgt gtttcaaaaa ttctactcat      2700
     agcgaaattt tgaatttgat ccctgagcat gtcacaaaac accctgcatt tgatctctac      2760
     cttcgtgaaa tggcggatta tgctccgcca aatgggccag tagatgctgg catctatacc      2820
     ctaaaggaga agtacttttc tttgatcgat ccttatttca ttgggttttc gcccagcaag      2880
     agattcgagg cggagaaact tattaggaaa aggttatcca tcgaaactca gacagattat      2940
     aacatgtcat atatccccgc gagagacttc gcatcatgtt tgaaagaaac accttacaag      3000
     aatctctatc aaatatgcag tacagagatt tttggatgct tcttgaagaa tacccttgac      3060
     cacatcaaca aattcaacta tgaatctatg ctgaccaaag ctacccactt ggttcactta      3120
     tgtgttgtca acgacctttt ggggtttact agtatttttt ggaaagagta cgggttttcc      3180
     aattcagaat atctttacaa cagcagcatc gggtctttgc tctattcttt tctcttcaaa      3240
     gaagaatttg tcaacgagca tggaaaaatt cgtgaaatat tccagcattt catgaaatac      3300
     gctccccatg tcaatattga agggtacttg accgaacaga ctccctcatt caattttgaa      3360
     attctgaaga ctccattcaa gacaaccgaa cggaaggacg aggagtacga aaagaggaag      3420
     cagcttgcca aacacaaacg tgaaaagata atgaaaagaa ttgctaagca gcagcaaaaa      3480
     tttcttgcta ataaccatat atcgttggaa gacgagtctg gtagcctttg caagaaccgg      3540
     gatcaagggg agaatcagtt tttccctgag atgacatgtg tattttgcaa aatgcacaaa      3600
     gttaacgata cattcatata ttttgcttac ctcgagagga atatctgtga agccgaagtt      3660
     gaattggatt gggagctgtc gcatgctcgc gttagcgcaa taccaaaaga gggcggcaga      3720
     agtcacagca atgaggctgc aagagacatg gatattgtgg aaatgccaca aagcctatca      3780
     agcaagataa gcgtgttccc tgtgttacgc acatgcggcc atgggtcgca tgtttgttgc      3840
     cttacgagtc atatgaaatc taccaggaca gttcataatc atatcacaaa aaacataccc      3900
     agctcgcttg ggttctcttt gatgttctgt cccctatgct ccgctcttac caactgcttt      3960
     ctaccgcgaa tgtgcggtga tagctcagga agcgccccga acccatctga accaatagag      4020
     agaaatgatc cttttgaatc ttcgcttaag aactgcaata gatcagtagc tgtacttcgt      4080
     gagcttgtac aaatggatgg tgttggtgaa agtcccattc aagtgctcaa ctatatttac      4140
     aggaacactt tacgaaatac agaactagca acaaggctca agcgcccaca cagagagacc      4200
     gtcaaagaat gttcagattt tgcttctcat caacaattgc tgaccttgag gctgctttcc      4260
     gatctgagac gcatatactc ccagttttct gagcccaaag aatatgtttc tcccaaggag      4320
     tatagtttgt ttccaccgcc attcaaatac acaccgaacc agaaatcaac aaaacaagag      4380
     tgtgaacttg atcttttgaa tcttgcagat tatcggattc ttaatacaga ttttggctca      4440
     aaggtttgtg tcaaagaatt cttattagag ttcattaaca aaggcttgca tcaagatttc      4500
     ctagcaatct gtggaagcat tgcgacaaag ggtagccgag aggtcaccgc atgcaaacat      4560
     cagctacaaa agaaaacttc cttcacttca agtgaagaga aacacgtttt ttgtattctg      4620
     agaagctatc tttcgaattt ttctaccgcc gatctcacgg ctgttgaact agcaacctcc      4680
     atcaccagag gtgtgttaaa agattcaatg gtaattcgac tcagacgcct ctttgccttg      4740
     ctttacttcg gaggaactcc ggaattcgaa ctcaaagaac gcatcattga ctttggagta      4800
     ttaggcgatc ttttgaaggg cttcgacttg ccagatttta gcgagttact tcagaattac      4860
     attgacagag atttgcaaca aatgctgaaa cacgttgaac tcacactcaa agagcaagga      4920
     gaagaggagc ttatcaagaa tgcaaacgca ttgaagattg gctgtttcaa aaagaatttt      4980
     ttgatcaact taccccaaag ctactcggaa ttcatgtcaa atgaagacga attccttcag      5040
     atgagagcga aaaagcaaga gatcgcaata tgtctcttct gtggatcacg cgttcgcgta      5100
     cagaatgcgg tccttttgca taattactct atcggagagt gtacaaacca ctctttaaat      5160
     gtttgccgag ttaacccgat atacgggtgc tttctgctgg ttaggagtaa caccgtatat      5220
     ctttcatacg ggcatagagg gacgttttat caggcaccat atttaaatag tcatggggaa      5280
     accgacgatg actacaggaa cggggcgccg gtgtttctcg acaggaacag atatttgcac      5340
     ctgagccaag atgttatctt aaacaacatg gttcctcact tggtcttccg gcttaccgag      5400
     aacacgcttg atctcggcgg ctgggaaagt ttgtaa                                5436
//

If you have problems or comments...

PBIL Back to PBIL home page