(data stored in SCRATCH zone)

EMBL: CU928166.PE145

CU928166.PE145       Location/Qualifiers
FT   CDS_pept        298170..303941
FT                   /locus_tag="KLTH0B03652g"
FT                   /old_locus_tag="KLTH-ORF15512"
FT                   /product="KLTH0B03652p"
FT                   /note="similar to uniprot|P19812 Saccharomyces cerevisiae
FT                   YGR184C UBR1 Ubiquitin-protein ligase (E3) that interacts
FT                   with Rad6p/Ubc2p to ubiquitinate substrates of the N-end
FT                   rule pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
FT                   the 19S particle of the 26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21510"
FT                   /db_xref="GOA:C5DCJ9"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ9"
FT                   /protein_id="CAR21510.1"
FT                   /translation="MIREGSADFQLHLRRTLQLIQNEPHFKKAKGPKDRAELDKLLKSF
FT                   IFRYLYFIVSNNGKFLPQLFTSVPHEKFPATLQEALDVDRASISRHDPFYVIDDSVANE
FT                   SHRHTGRNCGRKFQAGEPIYRCKECSFDDTCVLCIHCFNAKDHINHHVYTSICTHVNNG
FT                   ICDCGDVEAWNVPLNCKAETEDEGSESEGAFESPEMTYILELTLTEIFDHFLDVFNQNI
FT                   EPLPTMQRDITVKLRDMVQSEKSEEKEEFLQDLQYKNEDMQDLKKGLTEIEAPDYTVLV
FT                   YNDEYHNYSQATAALKQGVPDDKNTDKLTARIDGEGRAMLKCSKDISSVLSGFFAVRTN
FT                   GLSATLTAWSEYIQQEACKYIIAWVGHCLTIPNSSFQQGFRSAMGRVLCSGSERLPEAV
FT                   DVSLLVDKHFPAKHSEEDPYRYANLSVLDRENVVPFSHHKVLAEGETDHISLTLNKTEP
FT                   PSPKRYANSRLQLLLFFDNRYWKKLRKDIQDIVIPTMASSLEFKPIFCEQLVEIFNHMT
FT                   RSVAFMDREPQLTVLRESVVQLFTCPTNAYSIFQSGSFCDIMWSVIDIFTEFSKKDAGV
FT                   LVWQKVKKTNPTKSYSISFKQNLYSVETILSKVSDPNLLLRPKEFIAIVTLCKLFNGAW
FT                   KIKRKEGEHVLREDQNFIPYLEYTTSIYSIVQTVDKILENKRDEVDETLLLQAIKLLST
FT                   FLGHRTPSQTVYDSHEIIKFKVSKQPVAFMNPVHTLMSFLIEKVPLAKAFAALSGCNDF
FT                   LTISDFSLRAVVLCSQIDVGFWVRNGMSVLRQSSYYKNNPEMACYIRDVHLNQLTFLNE
FT                   KDDLVRLIYNILDRWELLEWFNGKEDFDKTVYEDKIVYILQQFIAFVYQLLTERQSFKI
FT                   FKSPEEKEYYQIKRAIMYGLYMEPLSYSSLLSAVPEYLTESTDQFDRALEDVSVYMGPK
FT                   GLMDNGVFKLKPELYKRIDPLQLPNMGNDFEHSASIIKARLAESGEDPKNTVLEPQLIS
FT                   PKFLDESAKNLGAFTRTKVFAKVIYNLLRVSIDLDEGTFLYALLHLVHSILKDDELVNG
FT                   KNSIPEVYISKPICNLLFIIIDIKSSVFSENVVAKADYLLESLIWKNPTSILESLVSSF
FT                   GEECVERYKARKLHQGINFEESEKGRKRRLAKERQEKILSKFSRQQHKFMKENQSEFGS
FT                   NDDDIEMADNGLSQAVEDYTCALCQDTSSVDAFVIPVYHENTPIFRNGDIRNVKEFGVE
FT                   WNRFQNNKDSATTYEEESVQNFREDGSKGSRKVFVSCNHYIHYKCFKRYAQKKRFSTNS
FT                   FICPLCQTFSNCVIPVAGYSPKPSESSIKELLQNSGAKSNIDHLHQTDPNEDFNGVFNM
FT                   FLEINKKNMYYDRHWATTPESQRPDVAYILAVHWANTISMLEVSARIADHPNDSLLQGK
FT                   EQKFRTLKNVLSSIAWLHKVLGRPSKEIIPYVNGEDTIWNQNQLFQFIVRRSLFSSEPI
FT                   TNVITGGLSVFSRQLLVDFLKGSTPNDVKMMREASANFGGIHDIDNETLDVLRDVCDIS
FT                   VSDEDTCRQLYSLAFASLIKNVLPTIRRCLILLKAINMLIMKSDEASLIVNGINLELVT
FT                   SSSTPEYINSVIGLITPFSSFNDLLRKSNSYVKSVTDPYLSNIPYEFTGIVKLMDLAPH
FT                   LNTYLTNSKEVKLREEHPARMRNAGNRLDFKICLTCGVKVHARNDRTELVRHLANHCFK
FT                   PFGLFLIPNLNEVTLILTNPRSSISISAPYLNSHGEAGRNAIQRGDLTALSLQRYEHLN
FT                   NVWLNSEVPGLISRVMGDEFRVLIVSNGVVLNFNRNVLRPRRANAEEPDGDSSSSEAED
FT                   DDLEGGEVRWEIRPEEFFEEAGIRFEGAGAIPGGDIRDFFQFINNLDTETDAFEEDEET
FT                   GGEAQGLANAFVPRFEFLPNFRNFNARNEDEPDDEDEDEVNHPVSDDIE"
     atgattcgag aaggaagtgc cgattttcaa ctacacttga gaaggacact acagttgatc        60
     caaaatgagc ctcatttcaa gaaggcgaaa ggtcctaaag acagagctga actggataaa       120
     ttgctgaagt cctttatttt ccgttacttg tactttatcg taagcaataa tggtaagttt       180
     cttccacagc tattcacatc ggttccacat gagaaatttc ccgcgacttt gcaggaggcg       240
     cttgatgttg atcgtgcttc aatttcacgt catgatccct tctatgttat tgatgattcg       300
     gtagcgaatg agagtcatag acatacaggt cgtaattgtg ggcgtaagtt ccaagccggg       360
     gaacccattt acaggtgcaa ggaatgtagc tttgacgaca cctgtgtgct ttgcatccac       420
     tgcttcaacg ccaaagatca tatcaaccac catgtgtata cgagcatctg cacgcatgtc       480
     aacaatggta tctgcgattg tggtgacgtg gaagcatgga atgttccact taattgcaaa       540
     gctgaaaccg aagatgaggg ttcggagagt gaaggagcct ttgagtcacc tgagatgact       600
     tatatactcg agcttacact gacggagata tttgatcact ttttagatgt attcaaccag       660
     aatatcgaac cgctacccac aatgcaaagg gatatcactg ttaaactcag ggacatggtg       720
     caatccgaga aatcagaaga aaaagaagag ttcttacaag accttcagta caaaaacgag       780
     gatatgcaag atctcaaaaa agggctcaca gagattgaag ctcctgacta tacggtctta       840
     gtttacaatg acgaatatca caactactct caggctactg ccgctttgaa gcagggggtg       900
     cctgatgata aaaacaccga caaattaaca gctaggattg acggggaagg aagagcgatg       960
     ctgaagtgtt cgaaagacat ttcaagtgtt ttgagtggtt tttttgctgt gagaacaaat      1020
     ggtttgagcg caacgttaac agcatggtct gagtacattc agcaagaagc ctgtaaatac      1080
     atcattgcgt gggttggcca ttgcctgacc atcccaaatt cttcatttca gcagggtttt      1140
     cggagcgcaa tggggcgggt gctatgctct ggaagcgaac gccttcctga ggcggtggat      1200
     gttagcctat tagtagacaa gcactttcct gccaaacatt ctgaagagga cccttatagg      1260
     tatgctaact tgtccgttct tgatagggaa aatgtggtac ccttcagtca tcacaaggta      1320
     ttggctgaag gggagactga tcacatttcc ttaaccctca acaaaacaga gccgcccagc      1380
     cccaaaaggt acgccaactc aagacttcaa ttgcttctat tttttgataa ccggtattgg      1440
     aaaaagttac gcaaagatat tcaagatatt gttataccta caatggcttc aagtcttgag      1500
     tttaagccga tcttctgtga gcaattggtg gagatattca accacatgac aagatctgtc      1560
     gcgttcatgg atagagagcc acagttaacg gtgttgagag agagtgtggt tcaactcttt      1620
     acctgcccca caaatgctta cagcattttc cagagtggta gtttctgtga catcatgtgg      1680
     tcagtaattg acatttttac agagttctcc aaaaaagacg ctggcgtatt ggtatggcag      1740
     aaggtcaaga agactaatcc gacaaaaagt tatagtatct ccttcaaaca aaacttgtac      1800
     agcgtggaaa ccatattaag caaagtcagt gacccgaacc ttctgttgcg tccaaaagag      1860
     ttcattgcca tcgtaacttt gtgcaaactt ttcaacggcg cctggaaaat aaagcggaaa      1920
     gagggagaac atgtgctaag agaggatcaa aattttattc cttacctaga gtacacgacg      1980
     tctatttaca gcattgttca aacagtggac aagattttgg agaataagag agatgaggtt      2040
     gatgaaacct tattgctgca agctattaag ctgctgagta cgtttttggg tcaccgcaca      2100
     ccctctcaaa cggtctatga ctcccacgag ataattaagt tcaaagtcag taaacagcca      2160
     gttgcattca tgaatccagt tcatacgctt atgtctttcc tgattgagaa agttccacta      2220
     gctaaggctt tcgcagctct aagtggatgc aacgattttc ttacaatttc tgacttttct      2280
     ttgagagctg tggtgctttg ctctcaaatt gatgtcggct tttgggtacg aaatggcatg      2340
     tctgttcttc gccagtcttc atactataaa aataaccccg aaatggcatg ctacattcgc      2400
     gacgtgcacc tcaaccagct aacgttcctc aatgaaaaag acgacttggt tagacttatc      2460
     tacaatatcc tagacagatg ggagctctta gaatggttta atggcaaaga agacttcgac      2520
     aaaactgttt acgaagacaa aattgtctac atcttacagc agtttattgc attcgtttac      2580
     caacttttga ctgagagaca gtccttcaag atcttcaaaa gccctgaaga aaaggaatat      2640
     taccagatca aaagagccat tatgtatggc ctctacatgg agccgttgtc atattcgagc      2700
     cttctatctg ctgttcctga atacctgacc gaaagtaccg atcaatttga tagagctctg      2760
     gaggatgttt cagtttacat gggacccaaa ggcttgatgg acaatggagt atttaaattg      2820
     aagccggaac tctacaaaag gatagacccc ttgcaattac caaatatggg caatgatttt      2880
     gaacacagtg catccatcat taaagctcgc ttggcagaaa gcggcgagga tcccaaaaat      2940
     actgttctgg aaccacaact tatttctccc aagttcttgg atgagtctgc aaagaatttg      3000
     ggggcattta cacgcacgaa agttttcgcc aaggttatat ataatttgct ccgagtgagc      3060
     atagacttgg atgaaggcac cttcctttat gccctcctgc atttggttca ctcaatatta      3120
     aaagatgatg aacttgtgaa cggcaaaaat tccatacctg aggtctacat ctccaaacca      3180
     atctgcaatt tgttattcat tattatcgac attaaatcga gcgttttctc ggagaacgtg      3240
     gttgctaaag ccgattatct cttggaaagc ttgatctgga agaaccctac aagcatcctt      3300
     gaatcacttg tctcatcctt tggtgaggaa tgcgttgagc gctacaaagc gaggaagctt      3360
     catcagggaa taaatttcga agaaagtgaa aagggtcgta aaagaaggct tgcaaaggaa      3420
     cgtcaggaaa agattctttc aaagttttca aggcagcaac ataaattcat gaaggaaaat      3480
     cagtctgagt ttggcagcaa tgacgacgac attgagatgg ctgacaatgg tttgtcccaa      3540
     gccgttgaag attatacatg tgcgttatgc caagacacta gctctgtcga cgcattcgtt      3600
     ataccagttt atcatgagaa cacacctatt tttaggaatg gcgacatccg caacgtgaaa      3660
     gagtttggtg tggaatggaa ccgcttccag aacaacaaag acagtgcaac cacatatgag      3720
     gaagaatcag ttcaaaattt ccgtgaagac ggttccaaag gctctaggaa agtgtttgtg      3780
     tcttgcaacc attacattca ctataaatgt tttaagcggt atgcccagaa gaagaggttt      3840
     tcgacaaatt cgtttatttg cccattatgc caaaccttct ccaattgtgt tatccctgta      3900
     gctgggtatt ccccaaagcc tagtgaaagc agtatcaaag aactgcttca gaattctgga      3960
     gcaaagtcca atattgatca tcttcatcaa acggatccaa acgaagactt taatggtgtt      4020
     tttaacatgt ttctcgagat aaacaaaaag aacatgtact atgaccgtca ttgggcaacc      4080
     actccggaaa gtcaacgacc agatgttgca tacatattgg cagttcattg ggccaacact      4140
     atctcaatgc ttgaagtgtc ggccaggata gctgatcacc cgaacgatag tcttctgcag      4200
     ggaaaagagc aaaagttcag aactttgaag aacgtcttgt cttctatcgc ttggcttcat      4260
     aaggttttgg gccgcccttc taaagagatt atcccttacg tgaacgggga ggatactatc      4320
     tggaatcaga atcagctttt ccagtttatt gtgcggcgtt cgctcttttc ttctgagccg      4380
     attaccaatg ttatcactgg agggctctct gttttctcgc ggcagttgct ggtggatttc      4440
     ttaaaaggtt cgacgcccaa cgacgtcaag atgatgcgag aggcttcggc aaactttggt      4500
     ggcattcatg acattgataa tgagactcta gatgttctgc gtgatgtttg cgacataagt      4560
     gtttcagacg aggacacatg ccgtcaactc tatagcctgg ctttcgcttc tctgataaaa      4620
     aacgttttgc caactattag aaggtgtctc atccttttga aggctatcaa catgctaatc      4680
     atgaagtctg atgaagcaag tcttattgtt aatggcataa atctggagct ggtgaccagc      4740
     tcttcgactc ctgagtatat caacagtgtg attggtttaa tcacgccctt tagctctttc      4800
     aacgacctct tgaggaagtc aaacagctat gttaaaagcg tcaccgaccc ttacctttct      4860
     aacatacctt acgaatttac aggcattgtt aagttgatgg acttggcgcc acacttgaat      4920
     acttatctca caaattcaaa ggaagtcaag ttgcgtgaag agcatccggc acgcatgagg      4980
     aacgcaggaa accgtttaga cttcaagatc tgtttaacat gcggtgttaa ggttcatgcc      5040
     aggaacgacc gtacagagct cgtgagacat ctagccaatc actgtttcaa gccattcggt      5100
     ctatttttga ttccgaactt gaatgaagta accttgatcc tgacaaaccc aaggtcttcg      5160
     atatcaattt cagctcctta cctgaactcg catggtgagg ccggccggaa tgccattcaa      5220
     agaggtgact tgacagcgct gagccttcag cgctacgagc atctcaacaa cgtctggctc      5280
     aatagcgagg tcccgggctt gattagtagg gttatgggtg atgagtttcg ggttttgata      5340
     gtttctaatg gagttgtcct caatttcaac agaaacgttt taagaccacg tcgtgctaac      5400
     gctgaagagc ctgacggtga cagcagtagc agtgaagcag aagatgatga tctagaaggt      5460
     ggagaagttc ggtgggaaat cagaccagag gagtttttcg aagaagctgg tataaggttt      5520
     gaaggtgcag gcgccattcc gggtggtgac attagagact ttttccagtt cattaataac      5580
     ttggacacag aaacagacgc attcgaagag gacgaagaaa ctggaggcga ggctcaggga      5640
     cttgccaacg ccttcgttcc taggttcgag ttcttgccaa attttagaaa cttcaacgca      5700
     cgaaacgaag atgagccaga tgatgaggat gaggatgagg tgaaccaccc agtatctgac      5760
     gatatagagt ag                                                          5772
//

If you have problems or comments...

PBIL Back to PBIL home page