(data stored in SCRATCH zone)

EMBL: CU928166.PE146

CU928166.PE146       Location/Qualifiers
FT   CDS_pept        join(304162..304164,304585..304797)
FT                   /locus_tag="KLTH0B03674g"
FT                   /old_locus_tag="Klth0B.mRNA.231.p"
FT                   /product="KLTH0B03674p"
FT                   /note="similar to uniprot|P22289 Saccharomyces cerevisiae
FT                   YGR183C QCR9 7.3 kDa subunit 9 of the ubiquinol cytochrome
FT                   c oxidoreductase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21511"
FT                   /db_xref="GOA:C5DCK0"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="InterPro:IPR036656"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK0"
FT                   /protein_id="CAR21511.1"
FT                   /translation="MAFSTIYNIFFKRNSIFVGTVFASSFVFQAAFDSAVTSWYEQHNK
FT                   GKLWKDVKAKLAQGGDDDDEDDEDDE"
     atggcttttt cgacaatcta caacatcttt ttcaagagaa actcaatttt cgtgggcact        60
     gttttcgcct cttctttcgt tttccaagcc gccttcgaca gcgctgttac ctcgtggtac       120
     gaacaacaca acaagggtaa gttgtggaaa gacgtgaaag cgaagttggc tcagggtgga       180
     gacgacgatg acgaggatga cgaggatgac gaatag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page