(data stored in ACNUC8465 zone)

EMBL: CU928166.PE148

CU928166.PE148       Location/Qualifiers
FT   CDS_pept        join(306104..306125,306192..306745)
FT                   /locus_tag="KLTH0B03740g"
FT                   /old_locus_tag="Klth0B.mRNA.237.p"
FT                   /product="KLTH0B03740p"
FT                   /note="highly similar to uniprot|P47064 Saccharomyces
FT                   cerevisiae YJL024C APS3 Small subunit of the clathrin-
FT                   associated adaptor complex AP-3 which is involved in
FT                   vacuolar protein sorting related to the sigma subunit of
FT                   the mammalian clathrin AP-3 complex suppressor of loss of
FT                   casein kinase 1 function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21513"
FT                   /db_xref="GOA:C5DCK2"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027155"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK2"
FT                   /protein_id="CAR21513.1"
FT                   /translation="MIHAVLIFNKKAQPRLVKFYTPVELPQQKLLIQQVYELISQRNSE
FT                   FQSSFLTTPPSLVHAGSDELSDDQDIQVIYKNYATLYFTFIVDDQESELAILDLIQTFV
FT                   ESLDRCFAEVNELDLIFNWQTLESVLEEIVQGGMVIETSVAKIVSAVDQLNRSSSGDNR
FT                   AGRFAGAGLGNALQSIVQAGFSGWGANQ"
     atgatacatg cagtcctaat ctttaacaag aaggcccaac ccagattggt caagttttac        60
     acaccagtag aactcccgca gcaaaaactg ctaatacagc aggtttatga actgatatcc       120
     cagagaaaca gcgagtttca gagctctttc ttgacaaccc caccatctct ggtccacgca       180
     ggctcagacg agctcagcga tgaccaagat attcaggtca tctacaaaaa ttacgcaaca       240
     ttgtacttca cattcattgt tgacgatcag gaatcagagc tcgccatcct ggacctaatt       300
     cagacgtttg ttgaatctct tgatcgatgc tttgctgaag tgaatgaact cgaccttata       360
     tttaactggc agactctaga gagcgtcctt gaggagatcg ttcaaggcgg tatggttatc       420
     gaaaccagtg tggcaaaaat tgtttctgcg gttgatcaac taaaccggag ctccagtggg       480
     gataatagag ctggtaggtt tgcaggggct ggtttaggaa acgcacttca gagtatagtt       540
     caggctggct tcagtggctg gggcgccaac caatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page