(data stored in ACNUC8465 zone)

EMBL: CU928166.PE153

CU928166.PE153       Location/Qualifiers
FT   CDS_pept        complement(313316..315457)
FT                   /locus_tag="KLTH0B03850g"
FT                   /old_locus_tag="KLTH-ORF15492"
FT                   /product="KLTH0B03850p"
FT                   /note="similar to uniprot|P53297 Saccharomyces cerevisiae
FT                   YGR178C PBP1 Protein interacting with poly(A)- binding
FT                   protein Pab1p likely involved in control of the extent of
FT                   mRNA polyadenylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21518"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="InterPro:IPR025852"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK7"
FT                   /protein_id="CAR21518.1"
FT                   /translation="MKGTYSGKRREGNGNSNNGINRNPNANTSSGAFYETEETTKNFND
FT                   RLNYLLATSISTEATVTVTTGVKYSGILAACNPEGSNGVDVVLKFPKVIDKGFATSNID
FT                   QLASDLKENLVIKGEDVAELQLHDVNFSGEGKVGKEAKEESGQKAEVKAEFKPSSKLAG
FT                   PATERKIKAEFKTDTDISGANTVIKERELEKWVPDDHETFDMNESLEDSTTSWNQFAVN
FT                   EEKFGVTSTFDEHLYTTRINKDDPNYLHRLKEADRIAKEIESQGASGNVHLAEERGIIV
FT                   DDSGIDEEDKYSGVDRRGDELLAALKLNAKSNPPKAKKYVPPTLRSQPHNADPAIISSK
FT                   AAVISPQTVHPKEHKNQELAPEGGHSHSRKKNQLDELKEFSEKFKVPYEMPEEVKAMLK
FT                   KSSENSPKAPQAALKVNPSLPPKPTSTPPTNPNSSASSKNARATRDLTPSANKAELRKP
FT                   PARMSQGHTPVHSPSSGRHANISRRRNISQGSFFGSKCPLANKKDFSKNFNMFIKGKEA
FT                   FEQNRAAGKSKGGAASVFVIEKPYFTAPTWFSNVEQSYRTMFPDEHTAIQRSQMKMQQR
FT                   SMSAMSSPGSPHMMGVPGMMMGMPMGPSGSPNPYMMAPNASANMYMPFQPPAFYPPVMQ
FT                   MMPMGDERGGSGTPPPQNTGSPLGGPTFMNAGPGGPIPPFNYSAAAPFQPVMGSRSFRQ
FT                   GFQNQSYQNHHNRHRAHDR"
     atgaagggaa cctatagtgg caagagaaga gaaggcaacg ggaattctaa caacggtata        60
     aaccggaatc ccaatgcaaa tactagcagc ggtgcctttt acgaaacaga ggagacaacc       120
     aaaaacttca atgatcgtct gaactatctc ctagctacta gcatctcaac tgaagcaaca       180
     gtgaccgtta ctacgggcgt gaaatattca ggtatcttgg ccgcatgtaa tccagagggg       240
     tctaacggcg tcgatgttgt gctaaagttt cccaaagtca tcgacaaagg tttcgcaacc       300
     agcaacatcg accagttggc gagcgatttg aaggagaacc ttgtgatcaa gggcgaagat       360
     gtggcggagc tccaactcca cgacgtgaat ttctccggcg aaggaaaggt tggtaaagag       420
     gcaaaggagg aaagcggaca gaaggccgaa gtgaaggccg agttcaaacc ttccagcaag       480
     cttgcaggtc ctgccaccga acgcaaaatt aaagctgaat ttaaaacgga cacagacata       540
     tccggagcga acacagttat taaggagcgt gagctcgaga aatgggttcc tgatgatcac       600
     gaaacttttg acatgaatga gagcctggaa gacagcacca cgtcctggaa ccaatttgct       660
     gtgaacgagg agaagttcgg cgtcacttca acattcgacg agcatttgta taccacgaga       720
     ataaacaagg acgatcccaa ctacttacat cgtctgaagg aggctgatcg aatcgcgaaa       780
     gaaattgagt cccaaggtgc ttcaggcaat gtgcacttag ccgaagagag aggtattatt       840
     gtggatgact ctggtataga cgaagaagac aagtattcgg gcgtggaccg taggggagat       900
     gaactgcttg ctgctctcaa actaaatgcc aagagcaacc caccaaaggc caaaaagtac       960
     gtgccaccaa ctttgagaag ccagcctcac aacgctgacc cagctattat ctcgtcgaag      1020
     gccgcagtta tctcgccaca gaccgtacac cccaaagagc acaaaaacca ggaactcgcg      1080
     cccgaaggag gacactctca ttctcgcaaa aagaaccaac ttgacgaatt aaaggagttt      1140
     tccgagaagt ttaaagttcc ttacgaaatg cctgaggagg tgaaggccat gttgaagaaa      1200
     agcagtgaaa attctccaaa ggctccacaa gccgctctga aggtgaatcc ttctctgccc      1260
     ccaaagccaa catccactcc tcccaccaac cctaactcgt ctgcatcctc gaagaacgct      1320
     agagctacac gggacctaac tccttcagca aacaaggcag agttgagaaa accacccgca      1380
     agaatgtcgc agggccatac cccagtgcac tcaccatcat ccgggagaca cgcaaacata      1440
     tcaaggagac gcaatatcag ccagggatcg ttttttggat caaaatgtcc tcttgcaaac      1500
     aaaaaagact tctcgaagaa tttcaatatg tttatcaaag ggaaggaggc atttgagcaa      1560
     aatcgtgcag caggaaagtc aaagggcggc gcagcttccg tttttgtcat cgagaagccc      1620
     tacttcactg cccctacatg gttcagcaac gtggagcagt cctacagaac aatgttccct      1680
     gatgagcata ccgcgattca acggtcacag atgaagatgc aacaacgcag catgagcgcc      1740
     atgtcatctc caggaagccc acatatgatg ggtgtccctg gaatgatgat ggggatgcct      1800
     atgggcccca gcgggtctcc aaacccctac atgatggctc ctaacgcaag tgctaatatg      1860
     tacatgccgt ttcagcctcc cgccttctat ccgccagtaa tgcaaatgat gcctatgggt      1920
     gatgagagag gaggctctgg gacaccgcct ccccaaaata ctggctcccc acttggcggg      1980
     cccactttca tgaacgcagg cccggggggt cccattccac cattcaacta ctcagcggct      2040
     gcccccttcc agcccgtaat gggctcacgg tccttccggc aaggtttcca aaaccagtcc      2100
     tatcaaaatc atcacaatcg gcacagggcg cacgatcgtt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page