(data stored in SCRATCH zone)

EMBL: CU928166.PE154

CU928166.PE154       Location/Qualifiers
FT   CDS_pept        complement(315749..316837)
FT                   /locus_tag="KLTH0B03872g"
FT                   /old_locus_tag="KLTH-ORF15487"
FT                   /product="KLTH0B03872p"
FT                   /note="weakly similar to uniprot|P53298 Saccharomyces
FT                   cerevisiae YGR179C OKP1 Outer kinetochore protein required
FT                   for accurate mitotic chromosome segregation forms a complex
FT                   with Mcm21p and Okp1p that binds to centromeres via the
FT                   CBF3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK8"
FT                   /protein_id="CAR21519.1"
FT                   /translation="MSLQKPLLDAIVESDHEGSVMVDHATDDSTSEVDESFVQLDGDEF
FT                   RLDQEARRKGPVGKKLFVEEDSIAESPLRNGLLGPSLIASSPQKSDLESPSKRVQFKHH
FT                   IDSASEEEPISEQPIDQWNFKDLIGDRFRERLPETDLKAWQRPSKRLLNSITDILENNI
FT                   DLALEATFEKYEAECERLAIGRSVKHIRRDKERMLHKTIGKIERQLQSSKFPSRVKDRD
FT                   FDIEYIYAKRTFIQNSFSQELEHTDSVEHQVLREQKALEDLKHVQAKLSNRALRQTKLL
FT                   TEQLSHNLHPALSKAMVNSFGLIGDNAINKERYKKDVDELNLKLADPSAGVTHSLLHKY
FT                   LPSLKNYEKTAEKLQGSLPNLN"
     atgagccttc agaagcccct gcttgatgct atcgtggaat cggaccacga agggagtgta        60
     atggttgacc atgcaaccga tgactcgaca agcgaggttg atgaaagctt tgttcaactt       120
     gacggagacg agttcagact tgaccaagag gctagacgaa aaggtcctgt tgggaagaag       180
     ctatttgtcg aagaagacag catagctgag tcgcctcttc ggaatggcct gctgggtcca       240
     agtcttatag cctcttcacc tcagaagtct gatttggaaa gcccgtcaaa acgtgttcag       300
     ttcaagcacc atattgattc tgcaagcgag gaggagccaa tctcagaaca gccaatagac       360
     caatggaact tcaaagattt gatcggggat aggttccggg aacggctacc agaaaccgac       420
     ctcaaagcct ggcagcggcc ctccaaaaga ctgcttaata gcataacgga cattttagag       480
     aataacatcg acttggcttt ggaagctacg tttgaaaagt acgaggcaga gtgcgagcgg       540
     ctggctattg gtcgcagcgt taagcacatc cggagggaca aggaacgcat gttgcataaa       600
     acaatcggga aaatcgagcg gcaactccag agttccaagt ttccttcccg cgttaaagat       660
     cgcgatttcg acattgaata catttacgcc aagcggacct tcatccaaaa cagtttttct       720
     caagagttag agcatacaga ttcagtcgag caccaggttt taagggagca gaaagccttg       780
     gaagacttga agcacgttca agctaagctt tcaaatcgtg cgcttagaca aaccaagctc       840
     cttacggagc agctgtcaca taatcttcat ccagcattga gtaaagcaat ggtcaactca       900
     ttcgggctca taggggataa tgccataaac aaggagcgct acaaaaaaga tgtcgatgaa       960
     ctcaacttaa agctagctga cccgtccgct ggtgtcactc attccctgct tcacaaatat      1020
     ttgccctctc taaaaaacta cgaaaagact gccgagaagc tacagggtag tctcccgaac      1080
     ttaaactaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page