(data stored in SCRATCH zone)

EMBL: CU928166.PE155

CU928166.PE155       Location/Qualifiers
FT   CDS_pept        complement(317072..318892)
FT                   /locus_tag="KLTH0B03894g"
FT                   /old_locus_tag="KLTH-ORF15485"
FT                   /product="KLTH0B03894p"
FT                   /note="weakly similar to uniprot|P53283 Saccharomyces
FT                   cerevisiae YGR138C TPO2 Polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21520"
FT                   /db_xref="GOA:C5DCK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK9"
FT                   /protein_id="CAR21520.1"
FT                   /translation="MASISSSELESIQSHAQEYTPHQEKVSGDGATGAQTHRMMSKESD
FT                   EAELRKLLTAHSRGVQKRLSRLESNTHGIGPVEPPLDLERRETRPAPDSTFHEQDKWKY
FT                   PIDEETGMRIVEFIDDDSEDPRNWPTRQKWNYTVLLGIICFDVAMMSAIITGDMDSPAA
FT                   YFGVSMEVMCLCVSLMVWGFGLGPMLFAPLSEEFGRNPVYLVTLFIAVVFIVPCGAAKN
FT                   IGTLLAFRFLDGLAFSAPMCLIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSL
FT                   LSVKCSWRWVYWFMVIFSGCLYAVMAVFLPETHHQTLLKKRAKKLRKLTGDPSYRAICE
FT                   IKVRSMKEVAQETLFRPLVLLTELIVFLITMYMSVIYGLLYMFFFAYPMVYTEGKHYGA
FT                   IKTSIMFIPVGAGVIGSTVAAPFLNKDYVKRAQRYLDRGEVPPAELRLIPMMIGCWFVP
FT                   AGLFAYAWSSYPRLSWAGPCFSGFACGFGFNMLYNPANNYIVDSYQHYAASGLAAKTFV
FT                   RSMWGGAVPLFTIQMYRRLNYEWASTLMAFISLACCAIPYLFYFYGARIRQKSKYAYSP
FT                   SVDTTNTTRTDIENQAAGSHSSNSEGSSKV"
     atggcatcga tcagttcttc agaactggaa agcatacagt cacatgctca agaatacaca        60
     ccacaccagg aaaaggtgag cggcgacggc gccacgggcg cgcagacgca caggatgatg       120
     tcgaaggagt ccgacgaggc cgagctgcgt aagctgctca ccgcgcacag ccgcggtgtt       180
     cagaagaggc tatcgcgtct cgagtccaac acgcacggga tcggccctgt ggaacctccg       240
     ctggatctcg aaaggcgtga aacgcggcct gcgccggatt cgacgttcca cgaacaggat       300
     aaatggaagt accccatcga cgaagaaacc ggcatgagaa tagtggagtt tatcgacgac       360
     gacagcgagg accctagaaa ctggcccacg cgtcagaagt ggaactacac cgttctgctc       420
     ggtatcatat gtttcgacgt cgccatgatg tctgcgatca tcacaggcga tatggacagc       480
     cccgctgcgt atttcggggt ttccatggag gtcatgtgcc tgtgtgtctc tttgatggtg       540
     tgggggttcg gtctcgggcc catgctcttc gctcctctat ctgaggagtt tgggagaaat       600
     cccgtttacc tggtcactct gtttattgct gtcgtcttca ttgttccctg cggtgcagcc       660
     aagaacatcg gcacactttt ggccttccgg tttttggacg gactcgcctt tagcgctcct       720
     atgtgtctaa ttggaggctc tttgagcgac atgtggagaa ataaagagcg tggtgtggcc       780
     atgtctttat tttctgcagc tcccttcttg ggacctgtca tgggcccaat cgtcggttcg       840
     ctgctctcag tcaagtgctc ctggagatgg gtctactggt ttatggtgat tttcagcggt       900
     tgtctgtacg ccgttatggc cgtcttcttg cctgaaacac accatcaaac ccttttgaaa       960
     aagcgcgcaa agaagttgcg taagctaaca ggagacccat cttaccgggc catctgcgaa      1020
     ataaaggtga ggtcaatgaa ggaagttgcc caggaaactt tgtttaggcc cttggtttta      1080
     ctcactgagc tcattgtttt cctcatcacc atgtacatgt ctgtcattta cggtctgctt      1140
     tacatgttct tcttcgcata cccgatggtc tatactgagg gtaagcatta tggtgccatc      1200
     aagacaagca tcatgtttat cccagttggc gctggtgtta tcggttcaac agtcgccgca      1260
     ccattcctca acaaagacta cgtgaagaga gcccaacgct atctggatag gggcgaggtt      1320
     cctcctgcag agcttagact aatacccatg atgatcggct gctggttcgt gcctgcaggt      1380
     ctgtttgcgt acgcctggtc atcctatccg cgtttgtcgt gggcaggccc atgcttcagc      1440
     ggctttgcat gcggttttgg cttcaacatg ctttacaacc ctgccaacaa ttacattgtg      1500
     gattcttacc aacactacgc ggcgtcaggt ctcgctgcta agactttcgt gagatctatg      1560
     tggggtggtg cggttcctct ctttaccatc caaatgtacc gcaggcttaa ctacgaatgg      1620
     gctagtactt taatggcctt catttccctc gcctgttgtg caattccata cctgttctat      1680
     ttctacggag cgagaattag gcaaaagtca aagtacgctt attcgccctc cgtcgacaca      1740
     acaaatacca cgcgtactga catcgaaaac caggcggctg gcagtcactc gtcaaactca      1800
     gaagggagtt ctaaagtcta g                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page