(data stored in SCRATCH zone)

EMBL: CU928166.PE156

CU928166.PE156       Location/Qualifiers
FT   CDS_pept        320151..321128
FT                   /locus_tag="KLTH0B03916g"
FT                   /old_locus_tag="KLTH-ORF15480"
FT                   /product="KLTH0B03916p"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144W THI4 Protein required for thiamine
FT                   biosynthesis and for mitochondrial genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21521"
FT                   /db_xref="GOA:C5DCL0"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL0"
FT                   /protein_id="CAR21521.1"
FT                   /translation="MSTTTTNTETAQLQVSAGTIRHALSDVVKQEDWSDFQFAPIREST
FT                   VSRAMTSRYFQDMDKFAVSDVVIVGAGSSGLSAAYVIAKNRPDLKVACVESNVAPGGGA
FT                   WLGGQLFSAMIMRKPAHLFLDELELPYEDEGDYVVVKHAALFTSTVLSKVLLFPNFKLF
FT                   NATAVEDLVTRPADDNTGGVSVAGVVTNWTLVSMAHDLQSCMDPNVIELSGYQNDGTRD
FT                   PSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNKKLGGMKGLDMNRAEAGVVKGAGAYSG
FT                   VANMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAAEEILRHFAE"
     atgtctacca ccaccaccaa caccgaaacc gctcaattgc aggtgtctgc cggcacaatc        60
     agacacgccc tgtctgacgt tgtcaagcaa gaggactggt ccgacttcca gttcgcgcca       120
     atccgcgagt ctactgtgtc acgtgccatg acctcgcgct acttccagga catggacaag       180
     ttcgccgtga gcgacgttgt cattgtgggc gccggctcct cgggtctgtc tgccgcgtac       240
     gttatcgcca agaacagacc agacctgaag gttgcctgcg tggagtccaa tgttgcgcca       300
     ggtggcggcg catggctcgg tggccagctg ttcagcgcga tgatcatgag aaagcccgcg       360
     cacctatttt tggacgagct ggagctgcca tacgaggacg agggtgacta cgtggtcgtc       420
     aagcacgcgg ctctattcac ctcgaccgtg ttgagcaagg tgctactatt ccctaacttc       480
     aagctgttca acgcgactgc cgtggaggac ttggtcacga gacctgccga cgacaacacc       540
     ggcggcgtga gcgtcgctgg tgtggtgacc aactggacct tggtgtcgat ggcgcacgac       600
     ctacagagct gcatggaccc taacgttatc gagctgagcg gctaccagaa cgacggcacc       660
     cgcgacccta gcaagaagca cggtgtcatc ttgtcaacca caggtcacga cggtccattc       720
     ggcgcgttct ccgccaagag aattgtgtcg atcgacaaga acaagaagct gggcggaatg       780
     aagggtctgg acatgaaccg tgctgaggcc ggtgtggtca aaggcgctgg cgcttactcc       840
     ggagtcgcaa acatgtactt tgccggtatg gaagtggccg agctggaggg ctgcaacaga       900
     atgggtccaa ccttcggtgc catggctgtc agcggtatca aggctgctga ggaaatcttg       960
     agacactttg ccgaataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page