(data stored in ACNUC8465 zone)

EMBL: CU928166.PE159

CU928166.PE159       Location/Qualifiers
FT   CDS_pept        complement(324153..324614)
FT                   /locus_tag="KLTH0B04004g"
FT                   /old_locus_tag="KLTH-ORF15465"
FT                   /product="KLTH0B04004p"
FT                   /note="highly similar to uniprot|P36010 Saccharomyces
FT                   cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
FT                   catalyzes the phosphorylation of nucleoside diphosphates
FT                   into the corresponding triphosphates for nucleic acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21524"
FT                   /db_xref="GOA:C5DCL3"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL3"
FT                   /protein_id="CAR21524.1"
FT                   /translation="MSSQTERTFIAIKPDGVQRGLVAKILARFEDRGFKLVAVKLLRPS
FT                   QELLRQHYAEHVDKPFFPKMSAFMSSGPVLATVWEGKDAVRQGRVILGATNPLNSAPGT
FT                   IRGDFAIDMGRNVCHGSDSVESAQREIALWFQPEELVEWTPAQAAWVYE"
     atgtcgtccc agaccgagag aaccttcatt gccatcaagc ccgacggcgt gcagcgcggc        60
     ctcgtggcca agatcctcgc gcgcttcgag gaccgcggct tcaagctcgt cgccgtcaag       120
     ctgctcaggc cctcgcagga gctgctcaga cagcactacg cggagcacgt ggacaagcct       180
     tttttcccca agatgagcgc cttcatgagc tctggtcccg tgctcgccac cgtgtgggag       240
     ggtaaggatg cggtgcgcca gggccgcgtc atcctgggcg ccaccaaccc gctgaactcg       300
     gcgccgggca cgatccgcgg cgactttgcc atcgacatgg gccgcaacgt gtgccacggg       360
     tccgactcgg tggagtccgc gcagcgcgag atcgcgctct ggttccagcc ggaagagctg       420
     gtggagtgga cccctgcgca ggctgcctgg gtgtacgagt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page