(data stored in SCRATCH zone)

EMBL: CU928166.PE16

CU928166.PE16        Location/Qualifiers
FT   CDS_pept        complement(51712..53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /old_locus_tag="KLTH-ORF15934"
FT                   /product="KLTH0B00484p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21380"
FT                   /db_xref="GOA:C5DC70"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC70"
FT                   /protein_id="CAR21380.1"
FT                   /translation="MTVEEKLNGEVTEVGDVASSDQSIKVAAVFKEYEPEKEVLSEVDQ
FT                   IIREYELEDHRELLTRGALWANNPGILETESYSDEDRRVAKQAQERPLSSLSKHMLLAA
FT                   LCTSCAAINFGMDESAIGGAVLQYQKQFNITDPNIQGLTVAAPYLAAACLGSPLTIYLD
FT                   NYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLGIGMGLNSSTVPIYTAECSP
FT                   AISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLMIGSSAVAPFVTGILIFFP
FT                   PESPRWLIAHGKTRESLYSLMKLRPHELSGARDFYILHQSLKFESELENQLSSWQQFLS
FT                   LFTNRRNRFALIVSLIGILGQQYGGVNILVSYTTTILTNAGVDSVTAIAGSIGIGGGCF
FT                   LATFLSTQLIDRFGRRKMLLFTLPMEALCLFWLGGVLNVNDAQSRLGAGLASMYVYVLF
FT                   YGAGIGPVSFTLVAETSSITVRMAHSATCMFVNWILDFCLSMTWPKMESSMTASGGLYF
FT                   YGAFNIVVWILTFLCIPETMRFTLEQLDEIFKVGVSAHIKKSLHRIVRN"
     atgacagtgg aagaaaagtt aaatggggaa gttacagagg ttggcgacgt tgcatcttct        60
     gatcaatcaa tcaaagttgc agctgtcttt aaagagtatg agccagaaaa agaagttctt       120
     tctgaggttg atcaaattat aagggaatat gaattggaag atcatcgaga gctgttgact       180
     cggggcgcat tgtgggctaa taacccaggt atccttgaga ccgaaagcta cagcgatgaa       240
     gaccgtcgag ttgctaaaca agcgcaagaa aggccacttt catcgctatc taagcatatg       300
     ctgttagccg ctctatgtac ctcatgcgca gctattaact tcgggatgga tgaaagtgcg       360
     attggaggtg ctgttttaca ataccaaaag cagttcaata tcactgatcc taatatacaa       420
     ggtcttaccg ttgctgctcc ataccttgct gccgcttgtt tgggctcccc tcttactatc       480
     tacctcgaca attatgtggg aagaaaatgg attgtttttt tgagttgctt cattggattt       540
     gctgggtcgc tcatccaagg gttctcgaat ggacttggct gccttttatt cgcgaggttg       600
     tttcttggga ttggaatggg cttgaactct tccactgtac caatttacac agccgagtgt       660
     tctccagcga tatctcgcgg cgccatttta atgctatggc aaacattcat agcgctcggt       720
     gtatgcttgg gctcggtttt caatcgggct ttcgtcaata taagcggatc actttcatgg       780
     cgccttatga tagggtcttc ggcggttgct ccattcgtca caggaatttt aatctttttt       840
     ccacctgaat ccccaagatg gcttatcgcc cacggcaaaa caagagagtc tttgtactca       900
     ttaatgaaac ttagacctca cgaactctcg ggtgcgcggg acttttacat tcttcatcaa       960
     tcccttaagt tcgagtctga attagaaaat cagttatctt cttggcagca gtttttgtct      1020
     cttttcacta acaggagaaa caggttcgcc ttaatcgttt cactgattgg aattctgggt      1080
     cagcagtatg gaggtgtcaa catcttagta tcttatacaa caacaatttt aacgaatgcc      1140
     ggtgttgact ccgttacagc aattgcaggc tcaattggta ttggaggtgg ttgtttctta      1200
     gcaacatttt tgtcgacgca gctgattgac cgttttggga gaaggaaaat gcttctattt      1260
     actctaccca tggaggcctt gtgtttattt tggttgggag gtgttctcaa cgttaacgat      1320
     gcacaaagca gactgggtgc aggcctggct tcaatgtatg tgtacgtttt gttttacggt      1380
     gctgggattg gacctgtaag cttcactttg gtagctgaga cctcgtccat aaccgtgaga      1440
     atggcacaca gtgccacctg tatgtttgtg aattggattc tagacttctg tttgagcatg      1500
     acatggccaa aaatggaatc ttcaatgaca gcttcaggag gtctttattt ctacggcgct      1560
     tttaatattg ttgtttggat tttgacgttc ctatgtatcc cagaaacaat gcgctttacg      1620
     ctggagcagc ttgatgaaat attcaaagtg ggcgtttcgg ctcacattaa gaaatctttg      1680
     cacaggatag tccgcaacta a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page