(data stored in ACNUC8465 zone)

EMBL: CU928166.PE161

CU928166.PE161       Location/Qualifiers
FT   CDS_pept        326073..327434
FT                   /locus_tag="KLTH0B04048g"
FT                   /old_locus_tag="KLTH-ORF15456"
FT                   /product="KLTH0B04048p"
FT                   /note="weakly similar to uniprot|Q04213 Saccharomyces
FT                   cerevisiae YMR044W IOC4 Member of a complex (Isw1b) with
FT                   Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase
FT                   activity and acts within coding regions to coordinate
FT                   transcription elongation with termination and processing
FT                   contains a PWWP motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21526"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL5"
FT                   /protein_id="CAR21526.1"
FT                   /translation="MPPKKHIYQPTDIVLAKVKGFPAWPALVVPEEIAPANVLEERPGR
FT                   PTVEELDDEQNPENFIPYSDTLRFRKNFKPHNSYLLKFLCDDSYIWLKPTDFKPLTPEQ
FT                   CDAWLSKSSKKSKKLIPAFELARRGTHGPDAIDVLEFVQYGSSGKPAEEEYVEPAAEQE
FT                   EEDEEEGEAEPAAEQEPLDEDADADADQESPLSELPSSGSDSDFEDDTTHRRRPVRGTR
FT                   QSKRTRARTNEREPELQELQDEPAPKKARSHKKKQPQKVEVEKYKFEDDEDWSIVGLGP
FT                   QDPPVSKFNSLVNKLSQKRNLEVHNEFKADLRDRLGIVNKMLVGIVFDTKRKSVTEDLH
FT                   VLLDELEQCSALRGTQDELITVFLSDHELVINISALFNLKQDQLREAGLYDKLQQWYSQ
FT                   IYGGQFVADPVAWSLDKINDVHAPPQEDAPSAADAASNGAGPAAPPVTTSDANM"
     atgccgccca agaagcacat ataccagccc acagacatag tgctcgccaa ggtcaaaggc        60
     ttccccgcgt ggcccgcgct ggtggtgccc gaagagatcg ccccggccaa tgtgctagag       120
     gaaaggcccg gccgccccac ggtggaagag ctggacgacg agcagaaccc ggagaacttc       180
     atcccctaca gtgacacgct gcggttccgc aagaacttca agccgcacaa ctcatacctg       240
     ctcaagttcc tgtgcgacga ctcgtacata tggctgaagc ccacggactt caagccgctg       300
     acgcccgagc agtgcgatgc atggctctcc aagtcgtcca agaagagtaa gaaactgatc       360
     ccggcattcg agctggcgcg ccgcggtaca cacggcccgg acgccatcga cgtgttggag       420
     tttgtgcagt acgggtccag cggcaagccc gcggaggagg agtacgtgga gcctgcggca       480
     gagcaggaag aggaagatga ggaggaggga gaggcagagc ccgccgcgga gcaggagccg       540
     ctggacgaag acgctgacgc tgacgccgac caagagagcc cgctcagcga gctcccatcc       600
     tcggggtcgg actcggattt cgaggacgac accacccacc gccgccgccc ggtccgcggg       660
     acgcgccagt ccaagagaac tcgcgcgcgc accaacgagc gggagcctga gctccaggag       720
     ctgcaggatg agcccgcgcc caaaaaggcc cgctcacaca agaaaaaaca gcctcaaaag       780
     gtggaggtcg aaaagtacaa gttcgaggac gacgaggact ggtcgatagt tggattgggc       840
     cctcaggacc ccccggtctc caagttcaac tcgctcgtca acaagctctc ccagaaaagg       900
     aacctagagg tgcacaacga gtttaaagca gacctgcgag acaggctggg catcgtcaac       960
     aagatgcttg tcgggattgt ctttgacacg aagaggaaga gcgtcaccga ggacctccac      1020
     gtcctgcttg acgaactgga gcagtgctcg gcgctgcgag gcacccagga cgaattgatt      1080
     acggtatttc tctccgatca tgagctagtc ataaacatta gcgccctgtt caacctgaag      1140
     caagatcagc tgcgcgaggc cggactctac gacaagcttc agcaatggta ctcgcaaata      1200
     tatggcggcc agttcgtggc agatcctgtc gcttggtccc tggacaagat caatgacgtc      1260
     cacgcgcccc cacaagaaga tgccccatcg gccgcagatg ctgccagcaa tggtgctggg      1320
     cctgcagccc cgcctgtaac aaccagtgat gccaatatgt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page