(data stored in ACNUC8465 zone)

EMBL: CU928166.PE162

CU928166.PE162       Location/Qualifiers
FT   CDS_pept        complement(327578..331249)
FT                   /locus_tag="KLTH0B04070g"
FT                   /old_locus_tag="KLTH-ORF15451"
FT                   /product="KLTH0B04070p"
FT                   /note="weakly similar to uniprot|Q02629 Saccharomyces
FT                   cerevisiae YKL068W NUP100 Subunit of the nuclear pore
FT                   complex (NPC)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21527"
FT                   /db_xref="GOA:C5DCL6"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR036903"
FT                   /db_xref="InterPro:IPR037637"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL6"
FT                   /protein_id="CAR21527.1"
FT                   /translation="MFGSTGTAFGNSGSTPFGSAATPATTGASPFGSAAPNPTPAFGAA
FT                   QPSNAASGFGGFGAANSNPSAGGTGLFGMSNNSNSSSSTTGAAAPFGQATSAPANGPSL
FT                   FGSAVPTGAPNTSVPGAAQGPGTAIKPFSTYTEKDATTGSNNVFQSISCMPEYRAYSFE
FT                   ELRYQDYQANRRFPTGPVGSAGVASPFGAQTSSPFAQNNSTNTNAFGMVGNNNNNNNNN
FT                   TTGGLFGQNNTGAAGTSAFGQPAGGSLFGANNAANNSPFGLNKPASSGGLFGQPSNTAA
FT                   PGGSGLFGQSNNTAQGSGGLFGQNNNTGTTGSSMFGATNNAPGQQPGGLFGQPSTNTGG
FT                   GLFGQNNNANANNSPFGQSNTNTGGGLFGQNPNNGAANSPFGQNNQAQAGGGLFGNKSA
FT                   PSGGLFGQNNNTSGGGLFGQANNTNNSPFGQNNNAGGGLFGQNNSGNTGGGLFGQNNNN
FT                   NNTTGGGLFGQNNNNNNNAGGGLFGQNNNNATGGGLFGQNTANNSTFGQNSGSAPFGQS
FT                   QQQGSSLFGNKPAGSGGLFGQNNTASTGFGQNNSSAGGGLFGQNNNNNSTGNTGGLFGQ
FT                   NNTNTGSGLFGQNNSQQQQQQQPAGGLFGQNTQQNQGGLFGQNNANTGGGLFGQNNQQQ
FT                   QQQPSGGLFGAKPATGATGGGLFGQNNNQQPPATGGLFGQNNNANQPSTSGGLFGNKPA
FT                   GSTGGGLFGQNNTAGNTGTTGGGLFGQNNSTAANNSSGGGLFGAKPATNTGGGLFGNKP
FT                   AGAPTTGGGLFGSKPAGTATGTTGGGLFGAKPAGAATGGLFGNTNGTNNTNATGTQPGV
FT                   SGGLFGNQQNQQQAAPGSQPSLQQTGANPYGTNELFSRVLIPDSITQPTKPSATKLNAD
FT                   FKKKASLSGAYRLAPKPLFAPRSASTSPVARLGSTTTSQSNGRVLSVASSTDSLGREIV
FT                   PANTGSSSIFTNESDELILSSNDTLFNPDKKSFKNLIINRKKMEDTVDSKEDDQVLRIT
FT                   FKADGDSTSNEGVQGGAKTESTKIETPLYDDVQGTPLRQGSRIDAPFKNSVSTPLAKTP
FT                   LKSSNLASSSATSTTINEKPSGVIGDDISFMDDGYYISPSLETLSSMTLLQLRKVSGLT
FT                   IGRRDYGKIDFLEPVDLSNISLPALCGQLVVFEPKTCTVCPNASMQPAEGEGLNVRARI
FT                   STSGCYPVDKSTRKPIKDPNHPIIKRHINRLKSISDTKFDSYDPQTGTWVFTVDSPV"
     atgttcggct ccacaggaac ggcttttggc aactcgggct ccacgccctt tgggtccgcc        60
     gcgacccccg ccaccacggg cgcctcgcct tttggcagcg ccgctcccaa ccccacgcca       120
     gcgttcggcg ccgctcagcc gtccaacgcg gcctccggct tcggcggctt cggcgccgcc       180
     aacagcaacc cctcagccgg cggcacaggg ctctttggta tgtctaacaa cagcaactcc       240
     tcctcctcca ccactggcgc tgcggcgccc tttggtcagg caacatcggc tcccgccaac       300
     ggcccgtccc tgtttggctc agccgtgccc acgggcgccc ccaacacctc tgtcccaggc       360
     gcggcccagg gtcccggaac cgccatcaag cccttctcca cgtacacgga gaaggacgcc       420
     accacgggct ccaacaatgt gttccaatcc atctcctgca tgcccgagta ccgggcgtac       480
     tcctttgagg agctgcggta ccaggactac caggccaatc gcaggttccc aaccggcccc       540
     gtgggttctg ccggtgttgc ctcgccattt ggcgctcaga ccagctcgcc gttcgcgcag       600
     aacaatagca ctaatactaa cgccttcgga atggtaggca acaacaacaa taacaacaac       660
     aacaacacca ccggcgggct cttcggtcaa aacaacactg gggccgccgg tacctctgct       720
     tttggccagc ctgctggcgg ctcgctcttc ggcgccaaca acgctgccaa caattctccc       780
     ttcggcctga acaagcctgc ttcctcgggg ggcctgttcg ggcagcctag taacacggcc       840
     gcccccggcg gtagtggtct atttggccag tctaacaaca ccgcgcaagg ctccggcggt       900
     ttatttggcc agaacaacaa cacgggtacc actggcagca gcatgttcgg ggctacaaac       960
     aatgcccctg ggcagcaacc tggcggtttg ttcggccagc ccagcacgaa caccggaggc      1020
     ggactcttcg gtcaaaacaa caacgcaaat gccaacaact ctccttttgg ccaatcaaac      1080
     accaacacgg gcggcggcct attcggccag aaccccaaca acggggccgc caactctcct      1140
     ttcggccaaa acaaccaagc gcaagccgga ggtggcctct ttggaaataa gagcgctcct      1200
     tcaggcggac tatttggcca aaacaacaat acttcgggtg gtggcctttt tggtcaggcc      1260
     aacaacacga acaactctcc gtttggacag aacaataacg ccggaggtgg tctattcggt      1320
     cagaacaact ctggtaatac cggagggggt ttgttcgggc agaacaataa taacaataac      1380
     accaccggtg ggggcctctt cggccagaat aacaacaaca acaacaacgc aggcggtggc      1440
     ctctttggcc aaaacaacaa taacgccaca gggggcgggt tgtttggtca gaatactgca      1500
     aacaactcaa cctttggcca aaactctggc tccgctcctt ttggacagtc tcagcaacag      1560
     ggcagctccc ttttcggcaa caagccagcc ggttcaggcg ggctcttcgg tcagaacaat      1620
     accgcttcta caggctttgg acaaaacaat tcaagtgccg gtggtgggtt gtttggtcaa      1680
     aacaacaaca ataacagcac aggcaacacc ggagggctct ttggccagaa taacactaat      1740
     acaggcagtg gtctctttgg acaaaacaac agccagcagc aacagcaaca acaacctgca      1800
     ggtggtctct ttgggcagaa cactcaacag aaccaagggg ggcttttcgg ccagaacaac      1860
     gccaacaccg gtggaggtct tttcggccaa aacaatcagc aacagcagca acagccatct      1920
     ggtgggttgt ttggcgcaaa accagccact ggtgcgaccg gtgggggcct cttcggtcaa      1980
     aataacaatc aacagccacc agctactggg ggcctctttg gtcaaaacaa caacgccaac      2040
     caaccttcga cgtccggtgg gctctttgga aacaagcccg cgggctctac aggtggcgga      2100
     ttgtttggac aaaacaacac tgctggtaac acaggtacca ctggtggagg gctctttggc      2160
     cagaacaact ccactgccgc aaacaacagc tcaggcgggg ggctctttgg cgctaagcct      2220
     gctactaaca ccggaggcgg cctatttggc aacaagcccg cgggcgctcc aaccaccgga      2280
     ggcggcttgt tcggttccaa gcccgccgga accgctaccg gaaccaccgg cggaggtctc      2340
     tttggtgcta aaccagctgg cgccgctact ggcggtcttt ttggtaatac aaatggcacg      2400
     aacaacacca atgccactgg cacgcagcca ggtgtgtcag gtggtctttt cggaaaccaa      2460
     caaaaccagc agcaggcggc accaggctct cagccatcct tgcaacaaac cggcgccaat      2520
     ccatatggca ccaacgagct gttctcccgt gttttgattc ctgactctat tacgcagccc      2580
     actaagccaa gtgccactaa gttgaatgca gacttcaaaa agaaggctag tctttctgga      2640
     gcgtacagat tggcgcccaa gcctctcttt gctcctagaa gcgcgtcaac cagtccagtg      2700
     gctcgtttgg ggtctaccac tacttctcaa agcaatggaa gagttttgtc ggtggcatct      2760
     tccacagatt cgctcggcag ggaaatcgtg cccgcaaaca ctggctcatc gtctatcttc      2820
     acaaatgaaa gtgacgagct catactttct tctaatgata ccctgttcaa tcctgataag      2880
     aagtcattta agaacctcat tataaacagg aagaagatgg aagacaccgt cgattccaag      2940
     gaggatgacc aagtgttgag gatcacattc aaggctgatg gagattccac cagtaacgaa      3000
     ggggtccaag ggggtgctaa gacagaatca acgaagatcg agacacctct ttatgacgat      3060
     gttcaaggaa cgccactccg tcaaggaagc aggatcgatg cgcccttcaa aaacagcgta      3120
     tcgacgccat tggccaagac tccgttgaaa tcgtcgaact tggcaagctc ttctgccacg      3180
     tctaccacta taaacgagaa accatcaggt gttattggcg atgacatttc tttcatggac      3240
     gatggctact acatctcgcc atctcttgag accctgtcct ccatgaccct actgcagctc      3300
     cgcaaggtca gtggtctaac cattggccgc cgtgactacg gtaaaataga tttcctggag      3360
     cctgttgact tgtccaacat ctctttgccc gctctatgtg ggcagcttgt ggtcttcgag      3420
     cctaaaacgt gcacagtatg ccccaacgcg tcaatgcaac cagccgaagg cgaagggctg      3480
     aacgtacgtg ctcgcatcag cacctctggg tgctacccgg tggacaagtc taccaggaaa      3540
     cccattaagg atcctaacca tcctataata aagagacaca ttaaccggct gaagagcatt      3600
     tcagacacca agtttgacag ctacgaccca cagacaggca cttgggtctt caccgttgac      3660
     agtcctgtgt aa                                                          3672
//

If you have problems or comments...

PBIL Back to PBIL home page