(data stored in ACNUC8465 zone)

EMBL: CU928166.PE163

CU928166.PE163       Location/Qualifiers
FT   CDS_pept        332711..333547
FT                   /locus_tag="KLTH0B04092g"
FT                   /old_locus_tag="KLTH-ORF15433"
FT                   /product="KLTH0B04092p"
FT                   /note="weakly similar to uniprot|Q04659 Saccharomyces
FT                   cerevisiae YMR048W CSM3 Protein required for accurate
FT                   chromosome segregation during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21528"
FT                   /db_xref="GOA:C5DCL7"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="InterPro:IPR040038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL7"
FT                   /protein_id="CAR21528.1"
FT                   /translation="MSQQLQERFSDGTALSQDPDSSLLVDPTAINPSGLGPDGDAPLQD
FT                   PTAVTTRVRRPQVKLTAEKLCSAKGLPAVMKHAPRRLRISKRRSSYDNLCHLLQFYQLW
FT                   AHDLYPKAKFHDFVELCRNLGKTDPQLREYRIELLRQELEMGSALEEGAPAFPQERSPA
FT                   PEPTPDAPGIADLRSEPPSPAPAPAGADSDDDLIYNITRRAPARVLHDSDIDEDSLMET
FT                   QPPASSTAGDAPRSAESGPGPILNNNNNNNNNNKNNDDDDDDEDEDELAVMREMGL"
     atgtcccagc agctgcaaga acgcttctcc gacggcaccg cgctgtcaca ggacccggac        60
     tcctcgctcc tggtcgaccc caccgcgatc aacccgtccg ggctgggccc cgacggcgac       120
     gcgccgctac aggaccccac ggcggtcacg acgcgcgtgc ggcggccgca ggtcaagctg       180
     accgccgaga agctgtgctc ggccaagggc ctgcccgcgg tcatgaagca cgcgccccgg       240
     aggctgcgca tctcgaaacg taggtcctcc tacgacaacc tctgccacct gctgcagttt       300
     taccaactct gggcgcacga tctgtacccc aaggccaagt tccacgactt cgtggagctg       360
     tgccgcaacc tcggcaagac tgacccgcag ctgcgcgagt acaggatcga gctgctgcgg       420
     caggagcttg aaatgggctc tgcactcgag gaaggcgcgc ctgcgttccc gcaggagcgc       480
     tcaccagcac cggagcctac gccggacgcg cctggaatcg cggatctgcg ctctgagccc       540
     ccgtctcccg ctcccgctcc cgctggagcc gattccgacg acgacctgat ctacaacatc       600
     acgcgccgcg cgccagcgag agtgcttcac gacagcgaca ttgacgaaga ctccttgatg       660
     gaaacgcagc cgccggccag ctccacggcc ggcgatgcgc cgcggagcgc agaatcaggc       720
     cccggcccga tccttaacaa caacaacaac aacaacaaca acaataaaaa caacgacgat       780
     gacgacgacg acgaagatga ggacgaactc gcggttatgc gcgaaatggg tttgtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page