(data stored in ACNUC8465 zone)

EMBL: CU928166.PE164

CU928166.PE164       Location/Qualifiers
FT   CDS_pept        complement(333569..335644)
FT                   /locus_tag="KLTH0B04114g"
FT                   /old_locus_tag="KLTH-ORF15430"
FT                   /product="KLTH0B04114p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21529"
FT                   /db_xref="GOA:C5DCL8"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL8"
FT                   /protein_id="CAR21529.1"
FT                   /translation="MNAAQPSEGRSYIQYGVLALSLASLLKKSLSPSKEPINALNCAQD
FT                   EEKNITSTTFSQRVARRIISSALEKRSLKVGDLKKSQERLEYESSLKVLPQENETFVEH
FT                   TPPSVQSINITSTSHANGIPEYFLEEAPTLEALAYKNSKKAPKLLIPGWRAGTPLALEY
FT                   YLSTNSSYDRADFSPQDSSAWRGSLDSLDLDEPQTISENFKFRVPEGFGNDFVYLHLYL
FT                   MTSCEGSEEVGYTNCEYVSKNTIPLSYKLTKTEKAAKKNLLASKKKTREDNIGYELSYM
FT                   DDVPFWHPEITIYLGKPFGIVEADSVPKAMKSLISVDEGTKRDNLTGLAQRYSPPVLYN
FT                   NFWQMAHEMIEINTTTRELPINLRLEIPPAWKFRVYSTALHNLRELAMFGGASKANSSV
FT                   FTLDHYKLVWLGTKTSVLALTVIATVLHSALGVLALKSDTAHWQKRENHIGVSVRGLFA
FT                   NILMQALVMLYLLDNFEGTSSTVFVSQVVGFLIECWKVSTILKIQIVASREEASLNADT
FT                   EVVMMPLARGKRLAISNKHLLNEEEKKTREYDATAFRILLKVFVPLILGYAGFSLVYGE
FT                   HKSWYSFFVRVMVGIVYTYGFLIQLPAVYINYKLKSVAHMSKRAFAYKVVNTFIDDLFA
FT                   FVAKMPWLHKIATFRDDVVFFIYLYQFWAYRVDYARTNEFGEPAAAPGSEKAEKQE"
     atgaatgccg cgcaacctag tgaaggccgt agctacatac aatatggtgt gttggctctg        60
     tccctggcta gcttgttaaa gaaatcccta tctccttcca aagagccaat aaatgccttg       120
     aactgtgccc aagacgagga gaagaacatt acaagcacta ctttttctca acgtgttgcc       180
     cgtcgtatta taagtagcgc tttagagaag agaagtttga aagttgggga tttgaagaaa       240
     agccaagaga ggctagaata cgaatcctct ttaaaggttc tgccgcagga aaatgaaacc       300
     tttgtcgaac atacgccgcc cagcgttcag agcatcaata taacgtcaac tagtcatgcc       360
     aacggtattc ccgagtactt cttggaggaa gcgcccacac tggaagcctt ggcgtacaag       420
     aactccaaaa aagcgcctaa actattgata cctggatgga gagcagggac gcctcttgct       480
     ctcgagtact atttgagtac caattcctcc tacgacagag ctgattttag tccgcaagac       540
     tcgtcggctt ggagaggctc tcttgatagc ctggatttag atgaaccaca aactatcagc       600
     gaaaacttca aattccgggt gcctgaaggg ttcggaaacg acttcgtgta cttgcatctc       660
     tacttgatga caagctgcga gggctcggag gaggtgggtt acactaactg cgaatatgtt       720
     agtaaaaaca ccattccctt aagctacaaa cttacaaaga ccgaaaaagc agccaaaaaa       780
     aaccttctcg cttcaaaaaa aaagacgcgc gaggataaca tcggttacga gctttcttat       840
     atggacgacg ttcctttctg gcaccctgaa atcacaatat atttaggaaa gccgttcggg       900
     atagttgagg cagacagtgt gcccaaggct atgaagagct taatttctgt ggacgaaggc       960
     acgaagagag ataatttaac cggcctcgcg cagcggtatt ccccccctgt actctacaat      1020
     aacttctggc aaatggccca cgagatgata gaaataaata caactactag ggaacttcct      1080
     atcaatctga ggctcgaaat tccccctgca tggaagttca gggtgtacag tacggccttg      1140
     cataacttga gagaactcgc aatgtttggg ggcgcttcga aggcaaattc gtccgtcttc      1200
     actttagatc attacaagtt agtttggcta gggacgaaaa catctgtctt ggctctgacc      1260
     gtgattgcga ccgtactgca ttcggcccta ggcgtactgg cgttgaaaag cgataccgcc      1320
     cactggcaaa aaagagaaaa ccatattgga gtttccgtga gaggcctttt cgcaaatatt      1380
     ttgatgcagg cattagtcat gttatacctt ctcgacaact ttgagggaac atcgagcact      1440
     gttttcgtct ctcaagtggt cggatttttg atagagtgct ggaaagtgtc gacgattctc      1500
     aaaatccaaa tagtagcaag ccgagaagag gcctcgttga atgcggacac agaagtcgtg      1560
     atgatgccct tggcaagagg gaagcggctc gcgatcagca acaaacattt gctgaatgaa      1620
     gaggagaaga aaacacggga gtatgacgcg acggcgttca ggattttgct gaaagttttc      1680
     gtgccgctga tcctgggcta cgccggattc agtctggtgt acggggagca caagtcttgg      1740
     tactcctttt ttgtgagagt tatggtgggc atcgtctaca cctatggctt cctgatccag      1800
     ttgccggcag tctacatcaa ctacaagtta aagtccgtgg cgcacatgtc gaaaagggcg      1860
     ttcgcttaca aggtcgtgaa cacctttatc gacgacttgt tcgcattcgt ggccaagatg      1920
     ccctggctac acaagattgc cacgttcagg gacgacgtgg tttttttcat atacctgtac      1980
     cagttctggg cgtacagagt ggactacgcg agaacgaacg agtttggcga gcccgcggcg      2040
     gcgccgggga gcgagaaggc tgaaaagcaa gagtaa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page