(data stored in SCRATCH zone)

EMBL: CU928166.PE167

CU928166.PE167       Location/Qualifiers
FT   CDS_pept        340239..340847
FT                   /locus_tag="KLTH0B04224g"
FT                   /old_locus_tag="KLTH-ORF15421"
FT                   /product="KLTH0B04224p"
FT                   /note="similar to uniprot|P46671 Saccharomyces cerevisiae
FT                   YMR052W FAR3 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far7p Far8p Far9p
FT                   Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM1"
FT                   /protein_id="CAR21532.1"
FT                   /translation="MENSADSFEYLLHLTKGLSTECRSTRQGTERIEHLVKRLAKLTQT
FT                   SYEELSKNPGPQVLQKYRELGRESERDRLERENYALIYQIERQEYVCRRIWSLIDQVED
FT                   LLESIKKFVVEQQGHRLRTENEFLETVVHSRMANLQVNTEDLVEAKNASRTKLDLLTRE
FT                   LKDLCKQIDWNKMSDSEDATLLSRKVSEVESKYKLKLKS"
     atggagaatt ctgctgacag ctttgagtat ctgctccatc ttaccaaggg actcagtaca        60
     gaatgcaggt caacaaggca agggaccgag aggattgaac atctcgttaa gagattggcg       120
     aaacttactc aaacgtccta cgaggagctg tcaaagaacc cggggccaca agtgttacaa       180
     aaatacaggg agctgggcag ggaaagcgaa agagaccggc tagaacgaga gaactatgcg       240
     ctaatctacc aaattgaacg gcaggagtac gtttgccggc gaatctggag ccttatcgac       300
     caggtcgagg acttacttga atccatcaag aagtttgtcg tggaacagca aggccacagg       360
     ttacgcaccg agaacgagtt tctggagacc gttgtgcatt cgcgcatggc aaatctgcag       420
     gttaacacag aggacctggt cgaagctaag aatgcgtctc gtactaagct tgacctgcta       480
     acacgagagc tcaaagattt atgcaagcaa attgattgga ataagatgtc agattctgag       540
     gatgctacac tcctttcacg caaagtatca gaagtggaaa gtaaatataa acttaaacta       600
     aaaagttga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page