(data stored in SCRATCH zone)

EMBL: CU928166.PE169

CU928166.PE169       Location/Qualifiers
FT   CDS_pept        join(343801..343825,343937..346512)
FT                   /locus_tag="KLTH0B04268g"
FT                   /old_locus_tag="KLTH.mRNA.153CN.p"
FT                   /product="KLTH0B04268p"
FT                   /note="similar to uniprot|P37296 Saccharomyces cerevisiae
FT                   YMR054W STV1 Subunit of vacuolar-ATPase V0 domain one of
FT                   two isoforms (Stv1p and Vph1p) Stv1p is located in V-
FT                   ATPase complexes of the Golgi and endosomes while Vph1p is
FT                   located in V-ATPase complexes of the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21534"
FT                   /db_xref="GOA:C5DCM3"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM3"
FT                   /protein_id="CAR21534.1"
FT                   /translation="MTREEAIFRSADMTYVQLYIPLELSREVVCLLGNMGNVMFRDLNT
FT                   DLTTFQRGYVNQIRKFDDLERLIDYMSNVASRYSEATWKYVFHGDNDNATQHPSMNFLM
FT                   SSMHTHSLDTVSDLTAEITEFESRVRQLDESLVNLRKRLNTLIEHRHAAFECGRYMEVN
FT                   PGLRGRAARSQQHRDLEQLTVEDFRLSDDEVSETLSDTFSFDEVSEDNSVPSAGRDLSA
FT                   ELEEGFRHRTTIIGSINRSKVETLNKILWRILRGNLFFHNIPIEEPLLEKGELVQKDCF
FT                   VVFTHGDVLLKKVKRVVESLNGTIFPGNEGRSTIKNLNTQIADLQQICQTTEQTLHTEL
FT                   LIVSDQLPMWRAVARREKLIYAALNLFRQESQGLVAEGWLPSTELLIVSNALKNHSENI
FT                   GSENSAVVSVIKTSKKPPTYHRTNKFTQSFQAIVDAYGIATYKEVNPGLATIVTFPFMF
FT                   AIMFGDTGHGAIVFLIALFLVLNEKKLAQAQNGEIFDMAFSGRYVILLMGFFSIYTGLL
FT                   YNDIFSLSMTFFKSGWKWNSGFKEGEAIEATNTGVYPFGLDYAWHGTENNLIFSNSYKM
FT                   KLSILMGFIHMTYSLFFSLVNYRYFRSRVDIIGNFIPGFIFMQSIFGYLSWAIIYKWSK
FT                   DWIKDGKVAPGLLNMLINMFLAPGVVDEPLFRGQSYLQVFLLLCALICVPWLLLYKPLK
FT                   LRAQNKAAISNGYQNIHDQNASESLLESQEDAGGEILVTDYDENHSNTFEFGDIMIHQV
FT                   IHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWTMTIANAFSSKDSGSPLAVIKVVF
FT                   LFGMWFVLTVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGDGYPYEPFSFKALD"
     atgacgcggg aagaggccat atttaggtcc gcggacatga catatgtgca actgtacatt        60
     cccttggaac tttcgcgaga ggtggtgtgc ttactcggaa atatgggaaa tgtgatgttt       120
     cgtgatctga ataccgatct aaccaccttt caaagaggct acgtgaacca gatccgcaaa       180
     tttgacgatt tggagcggct tatcgactat atgagcaacg ttgcaagcag gtactcggaa       240
     gctacttgga aatacgtctt tcatggcgat aacgacaatg ccacgcagca tcctagtatg       300
     aattttctga tgtcgagcat gcatacgcat tcactagaca ccgttagcga tctgaccgcg       360
     gaaatcacag agtttgagtc gcgcgtcagg cagttagatg agtctttggt caacttaaga       420
     aagaggctga atacgcttat agagcatagg catgcggctt ttgaatgcgg acgttacatg       480
     gaagttaatc ctgggctcag aggaagagcc gcgagatccc aacagcaccg cgatttagag       540
     caactgacag ttgaagattt taggctctct gacgatgagg taagtgagac gctcagcgac       600
     accttttcat ttgatgaagt ttcggaagat aactccgttc cgtccgctgg acgagatttg       660
     tccgcagagc ttgaagaggg gtttcgccac cgcactacaa ttataggctc catcaacagg       720
     agcaaagtgg aaactttgaa taaaatatta tggagaattt tgcggggaaa tctgtttttc       780
     cacaacatcc ccattgagga accgctgctt gagaaaggtg agcttgtgca gaaggactgt       840
     tttgttgttt ttacacacgg ggatgtgcta ctgaaaaaag tcaaaagggt agtggaatcc       900
     ctaaatggca caatatttcc tggcaacgag ggccgctcaa ccatcaaaaa tcttaacacc       960
     caaattgcag accttcaaca gatctgccaa accacggagc aaacccttca tactgaactt      1020
     ctgatagtct ccgaccagct tccaatgtgg agagctgttg cccgaaggga aaaactaata      1080
     tatgcagcac tcaatctttt caggcaagaa tcgcaagggt tagtcgccga ggggtggctg      1140
     ccctctactg aattgttgat agtctcgaac gcgctgaaga accatagcga aaacatcggc      1200
     tccgaaaaca gtgctgtcgt tagcgtcatc aagacaagta agaaaccacc cacttatcat      1260
     agaacaaaca agttcaccca atccttccaa gcaatcgtgg acgcatatgg aattgctacg      1320
     tataaagaag tcaaccctgg ccttgcaaca attgttacat tcccattcat gttcgcaatt      1380
     atgtttggtg acacgggtca tggtgcgata gtgtttttga ttgctctctt tttggtactc      1440
     aatgaaaaaa agcttgcgca ggcccaaaat ggtgaaatat ttgatatggc gttttccgga      1500
     agatatgtca ttttgctgat gggctttttc tcaatttaca ccggtctact gtataatgac      1560
     attttctccc tttcgatgac cttcttcaaa tctggatgga aatggaactc aggtttcaaa      1620
     gagggcgaag cgatcgaagc caccaataca ggtgtatatc cttttggtct tgattacgcg      1680
     tggcacggca ccgaaaacaa ccttattttc tcaaactctt ataagatgaa gctgtctata      1740
     ctcatgggct tcattcacat gacatactca cttttctttt cattggtaaa ctaccgttac      1800
     tttcggtcga gggtcgatat tattggtaac ttcattcctg gattcatttt catgcagtca      1860
     atctttggct atctttcatg ggctatcata tacaagtggt caaaagactg gataaaagac      1920
     gggaaggttg cgcccgggct gttgaacatg cttattaaca tgtttttggc cccaggcgta      1980
     gtcgatgagc ctctctttag aggccaatct tatttgcaag tctttctgct actttgcgca      2040
     ttgatctgtg tgccatggct tttgctttac aaacctttga agttaagggc tcaaaataaa      2100
     gcagcaattt ccaacggtta ccagaatatc cacgatcaaa atgcctctga aagtttactc      2160
     gaatcccaag aggatgcagg cggggaaatt ttagtgactg attatgacga gaaccattct      2220
     aatacttttg agtttggcga tattatgatt catcaagtta ttcacaccat tgaattttgc      2280
     ctgaattgta tatcccacac ggcctcatat ctgaggctct gggctttatc ccttgctcac      2340
     gcacaattat cgagtgttct ctggacgatg acaatcgcca atgccttcag ttctaaagat      2400
     tctgggtcgc ctttggctgt tatcaaagtt gtgtttttgt ttggcatgtg gtttgtcctc      2460
     acagtgtgca ttttagtgct tatggaaggt acctccgcaa tgcttcattc tttgcgtttg      2520
     cattgggttg aagctatgtc taaatttttt gagggtgatg gatatcctta tgaacccttt      2580
     tcattcaaag ctctagatta a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page