(data stored in ACNUC8465 zone)

EMBL: CU928166.PE181

CU928166.PE181       Location/Qualifiers
FT   CDS_pept        367438..367770
FT                   /locus_tag="KLTH0B04532g"
FT                   /old_locus_tag="KLTH-ORF15368"
FT                   /product="KLTH0B04532p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN5"
FT                   /protein_id="CAR21546.1"
FT                   /translation="MDAAGRLCSLLSCPTRAAPAMKRSSPDDCVYVASKKCQMYTACSG
FT                   TDAFRAMLRTARRASRPAAPAAFEQECYYCSSRAPTAVCGACHESVCTVCSAGGTATCL
FT                   NCRVAC"
     atggatgctg ctggccggct ctgttcactt ctttcctgcc ccacacgcgc agcgcccgct        60
     atgaagagat cctcgcccga cgactgcgtc tacgttgcct ccaagaagtg ccagatgtac       120
     acggcgtgct ccggcacgga cgcgttccgc gcgatgctgc ggaccgcgcg gcgtgcatcg       180
     cgccccgccg cgcccgcggc cttcgagcaa gagtgctact actgctcgtc ccgcgcgcca       240
     accgcagtct gcggggcctg ccacgagagc gtgtgcacgg tgtgcagcgc aggcggcacc       300
     gcgacgtgtc tgaactgccg cgtcgcgtgc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page