(data stored in SCRATCH zone)

EMBL: CU928166.PE183

CU928166.PE183       Location/Qualifiers
FT   CDS_pept        370504..373431
FT                   /locus_tag="KLTH0B04576g"
FT                   /old_locus_tag="KLTH-ORF15355"
FT                   /product="KLTH0B04576p"
FT                   /note="highly similar to uniprot|P16861 Saccharomyces
FT                   cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis indispensable
FT                   for anaerobic growth activated by fructose-2 6-
FT                   bisphosphate and AMP mutation inhibits glucose induction of
FT                   cell cycle-related genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21548"
FT                   /db_xref="GOA:C5DCN7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="InterPro:IPR040712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN7"
FT                   /protein_id="CAR21548.1"
FT                   /translation="MTQETVYGVAFRSVATADESAYRSAIKFYHKLGFSTVKTYDKFRG
FT                   NKEAATSGTAQGSVKETWLESFKLSEVDSNGFRIPQQEATNHEQSDGALLKIRLVAHQP
FT                   LEAKNSRVTYYSASIDEVSKAFPDAKKLENGEYALNDPLGYELRLSGYVRAGDKKTVDK
FT                   EFFLDESKTPADYLKGQNLSPNQIPGATSTGIKKKIAVMTSGGDSPGMNSAVRAVVRAG
FT                   IYYGCDVFAVYEGYEGLLKGGDLLKKMEWKDVRGWLSEGGTLIGTARCMEFRERWGRKQ
FT                   AAGNLISEGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGKFTEKQVEPYRNLKIV
FT                   GLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALM
FT                   AGIATGADYIFVPERAAPAGKWQEELKKVCQAHREKGRRNNTVIVAEGALDNNLKPITS
FT                   EQVKDALVELGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAVLEMTPETPSPLI
FT                   GILENKIIRMPLMESVKLTKSVAEAIENKDFDKAISLRDTEFIELYENFISTTVKDDGS
FT                   ERLPEDQRLNIAIVHVGAPSAALNAATRAATLYCLSRGHKPSAILNGFSGLIQTGEIKE
FT                   LSWIDVENWHNLGGSEIGTNRSVASEDMGSIAYHFQKNKFDGVIILGGFEGFKSLKELR
FT                   DARAQYPIFNIPMVLIPSTVSNNVPGTEYSLGVDTCLNTLVNYTDAIKQSASATRRRVF
FT                   VVEVQGGHSGYIASFTGLVTGAVSVYTPEDQIDLKSIREDLALLKENFRHDQGETRNGK
FT                   LVIRNEQASSIYTTDLLADIIAEASSGKFGVRTAIPGHVQQGGVPSSKDRVTGSRYAVK
FT                   CVKFIEAWNRKNSDEQNEDFKILRFKYVNGVKEYTIQDEDASAAIIAVNGSHISFKPIA
FT                   RLWEEETNVELRKGQEVHWEEFNKIGDILSGRLNLRKEVDAGKSA"
     atgactcaag aaaccgtgta tggagtcgcg ttcagatcgg ttgcgaccgc tgacgaaagc        60
     gcgtacagaa gcgctataaa gttttaccac aagctaggat tttccactgt gaaaacctac       120
     gacaagttca gaggcaacaa ggaggctgcg acctccggca ccgcccaggg ctccgtgaag       180
     gagacctggc tggaaagctt caagctgagc gaagtggaca gcaatggctt ccgcatccct       240
     cagcaagagg ccacgaacca cgagcagagt gatggtgctc ttcttaagat cagactagtg       300
     gctcaccagc ccctggaggc caaaaactcc cgggttacct actactccgc atccattgat       360
     gaggtttcca aggctttccc agacgccaag aagctcgaaa atggcgagta cgccttgaat       420
     gatccattgg gctacgaact tcgcttgtca ggctacgtta gagccggtga caagaagacc       480
     gtcgacaagg agttcttctt ggacgagtct aagactccag ctgactatct aaagggccag       540
     aacctgtctc ctaatcagat tccaggtgcc acctctactg gcatcaagaa gaagattgct       600
     gtcatgactt ccggtggtga ctctccaggt atgaactctg ctgtccgtgc tgtggtcaga       660
     gcaggtattt actacggctg cgacgtgttc gctgtttacg aaggttacga gggtctgcta       720
     aaaggtggtg atctcttgaa gaagatggaa tggaaagacg ttagaggctg gctcagcgag       780
     ggtggtactt tgattggtac cgctcgttgc atggagttca gagaacgttg gggccgtaaa       840
     caagctgccg gcaaccttat ttctgagggt attgacgctc ttgtggtttg tggtggtgat       900
     ggctccctaa cgggtgctga cctgttcaga tctgagtggc catctttggt ggaggagctt       960
     gtcaaggacg gtaaatttac cgagaagcaa gtcgaaccat acagaaactt gaagattgtg      1020
     ggtcttgtgg gctccatcga caacgatatg tctggtactg actctacaat tggtgcttat      1080
     tctgccctgg aaagaatttg tgagatggtc gactacatcg acgctactgc caaatcccac      1140
     tcgagagctt tcgtcgtcga ggttatggga agacactgtg gttggttggc tttgatggcc      1200
     ggtattgcta caggtgccga ctacatcttc gttccagaaa gagctgcgcc tgctggcaaa      1260
     tggcaagaag agttgaagaa ggtgtgtcag gcccacagag agaagggccg tagaaacaac      1320
     actgttattg ttgctgaagg tgccctagac aacaacttga aaccaatcac ctctgagcag      1380
     gttaaggatg ctttggttga gttgggactc gacaccaaga tcacaacttt gggtcatgtc      1440
     caaagaggtg gtacagctgt ggctcacgac agatggctcg ctaccttgca gggtgtcgac      1500
     gctgtgaaag ccgttttgga gatgactcct gaaacaccat ctccattgat tggtattttg      1560
     gaaaacaaaa tcatcagaat gccactaatg gagtctgtta agctcactaa gagtgttgcc      1620
     gaggcaatcg agaacaaaga ctttgacaaa gccatctctt tgcgtgacac cgagtttatt      1680
     gaactatacg agaatttcat ctcaactact gttaaggatg acggttccga gaggttgccc      1740
     gaggaccaaa gactaaacat cgctatcgtt cacgttggtg ctccttccgc cgccttgaat      1800
     gccgcgactc gtgctgccac cctgtactgt ctctcccgtg gccacaagcc ttctgctatc      1860
     ttgaacggtt tcagcggttt gattcaaact ggtgaaatca aggagctttc ttggattgat      1920
     gtcgagaact ggcacaactt gggtggttct gagattggaa ctaacagatc cgtggctagt      1980
     gaagacatgg gatcaatcgc ttaccacttc cagaagaaca agttcgatgg tgtcattatt      2040
     ttgggtggct ttgagggttt caagtccttg aaggagctac gtgacgcccg tgctcagtac      2100
     cctatcttca acatcccaat ggttttgatt ccttccactg tttcgaacaa cgttcctggc      2160
     accgaatact ctctaggtgt tgacacttgt ctcaacactc tggtcaacta cacagatgct      2220
     attaagcagt ccgcgtcagc cactagaaga agagtttttg ttgttgaagt gcaaggtggc      2280
     cactctggtt acattgcctc tttcactggt ctcgtaacag gagctgtgtc agtttacact      2340
     cccgaggatc agattgacct aaagagtata agggaagacc ttgctcttct caaggagaac      2400
     ttccgtcacg accagggcga gactcgtaac ggtaagctgg ttattagaaa tgaacaggcc      2460
     tcctccattt acactaccga cctcctggct gacatcattg ccgaagcgtc tagtggaaag      2520
     tttggtgtta gaaccgctat tccaggccac gttcaacaag gtggcgtgcc atcttctaag      2580
     gaccgtgtca caggttctag atatgctgtt aagtgtgtta aatttattga ggcctggaac      2640
     agaaagaact ccgacgaaca aaacgaagac tttaagattt tgagattcaa gtacgttaac      2700
     ggtgttaagg agtataccat ccaggacgaa gatgcttccg ctgccatcat cgctgtcaac      2760
     ggctctcaca tctccttcaa gcctattgct cgcctgtggg aagaagagac caacgttgaa      2820
     ttgagaaagg gtcaagaagt ccactgggaa gagtttaaca agattggaga catcctttct      2880
     ggtagactta acttaaggaa ggaagtcgac gctggtaaaa gcgcctaa                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page