(data stored in SCRATCH zone)

EMBL: CU928166.PE184

CU928166.PE184       Location/Qualifiers
FT   CDS_pept        complement(373616..375145)
FT                   /locus_tag="KLTH0B04598g"
FT                   /old_locus_tag="KLTH-ORF15349"
FT                   /product="KLTH0B04598p"
FT                   /note="weakly similar to uniprot|Q04746 Saccharomyces
FT                   cerevisiae YMR065W KAR5 Protein required for nuclear
FT                   membrane fusion during karyogamy localizes to the membrane
FT                   with a soluble portion in the endoplasmic reticulum lumen
FT                   may form a complex with Jem1p and Kar2p expression of the
FT                   gene is regulated by pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21549"
FT                   /db_xref="GOA:C5DCN8"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN8"
FT                   /protein_id="CAR21549.1"
FT                   /translation="MGASVIVVILWAFYFRLGNSDRLEIAGYKLLSLDDSDSLTDGLER
FT                   IVELNFPLYKSSCAMNALRDFLPKCIKHGIDTIDPKQRVNAAIKLSFCEFQESGLDELP
FT                   ESCQKSTQDGLKKCLDEMKSSAQWWTTYSGNYQRLPTLCYESSLPFEKEQLLDVFLNVT
FT                   RMYANFNEVLDLKLQRRFEEYEAAAEKNLFKVERIFEEYFSDFDNSYSARKAMFFQDFE
FT                   HYQKDVLLAFDKNVKVVQREVGSFESDIWQEVIALKQYIQEMNAELNASGPRDQIKSLK
FT                   VESLIQIQALRDSIRLASEDSISLLKSKDKSFNDFYSKTTEQLSKLDEALGNTYMDALV
FT                   VIQDLRGLVQNSITPLLREDIEKPLSQFSQNLAQNLEYLDENFCAKAELWVRSFDGTFQ
FT                   RVHADLNLTAQEVLHINEDLGNFTTTFESHLKALNISVKVFSASMSSLARLLRVVPPAA
FT                   RPFLAIALLRYCPTLLIRFFGSLFENVTQVSRVCAVLIALISGCALGFNLT"
     atgggagcta gtgtaatagt tgtgatactg tgggcctttt attttaggct tgggaactcc        60
     gacaggctcg agatagcagg ctataagtta ctctcattag acgactcaga ctcactcact       120
     gacggcttgg aaaggatcgt cgagctaaat tttccgcttt acaagagctc ttgtgccatg       180
     aacgctttga gagatttttt gcccaagtgc ataaagcatg gcattgacac aatcgatccg       240
     aagcagagag taaacgctgc catcaagctt tccttctgtg aatttcaaga atcaggcctc       300
     gatgagctgc ctgaatcttg ccaaaaatca actcaagatg gcttgaaaaa gtgcctagac       360
     gaaatgaaaa gctctgccca gtggtggaca acatatagtg gcaattacca gcgtttgcca       420
     acgttgtgtt atgaaagttc attgcctttt gaaaaagagc agctcttaga cgtctttttg       480
     aatgtcactc gaatgtatgc gaattttaac gaggtgctag accttaaact acaacgtaga       540
     tttgaagaat acgaggcagc tgctgaaaag aatcttttca aagtggaaag aatctttgag       600
     gaatatttta gtgactttga taactcctat tcagcacgca aggcaatgtt ctttcaagat       660
     tttgagcact atcagaagga cgtgctgctg gcatttgaca agaacgttaa agttgttcaa       720
     agagaggttg gtagttttga atcagacata tggcaagagg tcatagcatt gaagcagtat       780
     attcaagaaa tgaacgccga acttaatgcg tcaggcccga gagatcaaat caaaagtcta       840
     aaggttgaaa gtctaataca gatacaagct ttgagagata gtatcagatt agctagcgaa       900
     gacagcattt cgttactaaa atcgaaagat aaaagtttta atgacttcta ttcaaagaca       960
     acagaacagc tttcgaaact ggatgaagct ctcggtaaca catatatgga tgctctggtt      1020
     gttattcagg atctcagggg gttggtccag aattctatta ctcccctgtt gagagaggat      1080
     atagagaaac cattaagcca gttctcacag aacttagctc agaatcttga gtacttagat      1140
     gaaaactttt gtgcgaaagc tgaattgtgg gtcagaagtt ttgacggtac atttcagagg      1200
     gtacacgccg atcttaacct tacagcacag gaggttcttc acatcaatga agacctcgga      1260
     aatttcacca caactttcga gagtcacttg aaagcactga acatttcagt gaaggttttc      1320
     tctgcctcca tgagtagttt ggcgaggcta ctgcgagttg tgccaccagc tgcgcgtcct      1380
     tttttagcaa tcgcactact cagatactgc cccacgcttt tgatccgctt ttttgggagt      1440
     ttatttgaga acgtgacaca agtatctcga gtctgcgccg tcttaatagc attgatatca      1500
     ggctgcgctc ttggttttaa ccttacttag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page