(data stored in ACNUC8465 zone)

EMBL: CU928166.PE185

CU928166.PE185       Location/Qualifiers
FT   CDS_pept        complement(375653..377353)
FT                   /locus_tag="KLTH0B04620g"
FT                   /old_locus_tag="KLTH-ORF15348"
FT                   /product="KLTH0B04620p"
FT                   /note="weakly similar to uniprot|P32493 Saccharomyces
FT                   cerevisiae YMR064W AEP1 Protein required for expression of
FT                   the mitochondrial OLI1 gene encoding subunit 9 of F1-F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21550"
FT                   /db_xref="GOA:C5DCN9"
FT                   /db_xref="InterPro:IPR031467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCN9"
FT                   /protein_id="CAR21550.1"
FT                   /translation="MGSRIFSPRRLYSALSELKTETVIPKNPNKRTRDGSFRKFKRVAP
FT                   AIGDSMHPFYSPNIMERAILCASEIKPELLDGQPIVPAVIKQLKTLEPALVNTRWQPQS
FT                   TQGLNDWLEPFRKMRRKSSPLKLIENHEIDNVIRPSRIDSGRIPELRKFALMFEKEDAG
FT                   ILSASTIGSLIDRLAADQEKAVFSEEVFLYILQHYCKSSQGIASVVDSITEFLHKDIDD
FT                   LKTAETLLAHVLMALRRNSIPLTPRATSAILKLIDSVSTRFHRPFCVVDFSPAVVQMTT
FT                   EFYVDSGFLKESKVLFTDMVNKERCPSAQLVEKYLGLIESVCGISTSDNDFLKKFVYIS
FT                   NFRPIFQTTMTPRITEFLVSYCRHFDEILSLLVLVDHSKVKKQIWDLVLPQMIRRVSLL
FT                   TKDSAKNCCHLTVLYQKASRFYGMPLSTKVNKAFIIQYAVNGNFAMVARLLSIIDSNAF
FT                   PSFYASVLAAYDQSSAFSMEVPSSGAALKNKHQFMTSMIIPHYTEISFVGRQLALKHAD
FT                   TEELLEQVLKAEIAIKGRGGKSLLPQVSLKAQDCKSNYIITEAEKCLQH"
     atggggtcac gaatattttc gcccagaagg ctctactcag cgctaagcga acttaaaaca        60
     gaaaccgtga ttccgaagaa ccctaacaag cgcacgcgcg atggatcttt caggaagttc       120
     aagcgggtgg ctcccgctat tggagatagc atgcatccat tctatagccc caacatcatg       180
     gaaagagcaa tactatgtgc ttcagaaata aagcccgagt tgctggacgg acaacctata       240
     gttcccgctg tcattaaaca gctaaaaacg ctggagcccg cccttgtcaa cacaaggtgg       300
     cagcctcaaa gcacccaagg tttgaacgac tggttagaac ccttcaggaa aatgaggcgg       360
     aaaagttctc cactaaagtt aattgagaat catgaaattg ataacgttat aagacctagc       420
     agaatagatt cgggccggat cccagagctt cgaaagttcg cgttaatgtt cgaaaaagaa       480
     gatgctggca ttttgagtgc ttcaactatt ggaagcttga ttgacaggct ggccgccgat       540
     caagaaaaag ctgttttcag tgaagaagtg tttttataca ttcttcaaca ttactgcaag       600
     tccagtcaag gtattgctag cgtagtggat tctatcacag agtttttgca caaggacata       660
     gatgacttga aaactgcaga gaccctttta gctcatgttc taatggctct gaggcgtaac       720
     tctattccgc taaccccaag ggcaacgtca gcaatattaa aactgataga ttcggtatct       780
     acaagattcc acaggccatt ttgcgttgtc gacttttcgc ctgcagtggt acagatgacc       840
     acagagttct acgtggactc tggttttcta aaagaaagca aagtcctttt tacagacatg       900
     gtcaacaaag aaaggtgtcc aagtgcgcag ttagtggaaa agtacttggg actcatcgaa       960
     agcgtatgcg gaataagcac atctgacaat gactttttga agaagtttgt gtacatttct      1020
     aacttcaggc ccattttcca aacaacaatg acgccgcgga taacagagtt tttggtatcg      1080
     tattgtcgac actttgatga aattctatct ctactagtcc tcgtagatca ctcgaaagtc      1140
     aaaaaacaaa tttgggattt ggttcttccc caaatgataa gaagggtttc tctactcaca      1200
     aaagactcag ccaagaattg ttgtcacctc acagtccttt atcaaaaagc cagccgcttc      1260
     tatggaatgc cgctatctac taaagtcaat aaggctttca tcatccaata tgctgtaaac      1320
     ggcaattttg caatggtcgc acggctgtta tccattattg actctaatgc gtttccaagt      1380
     ttctatgcaa gcgttcttgc tgcttatgac caaagcagtg cgttcagcat ggaggttcct      1440
     tcttcggggg ctgctttgaa aaataagcat cagtttatga catccatgat tatcccgcat      1500
     tacacagaaa tttcatttgt tggaaggcaa ttagcattga agcacgcaga tacggaagaa      1560
     cttcttgagc aagttttgaa ggcagagatt gccatcaagg gcagaggggg gaagtccctg      1620
     cttcctcagg tctcgttaaa agcacaggac tgtaagtcta actatattat cacagaggct      1680
     gaaaaatgtt tacagcatta a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page