(data stored in ACNUC8465 zone)

EMBL: CU928166.PE188

CU928166.PE188       Location/Qualifiers
FT   CDS_pept        381618..381932
FT                   /locus_tag="KLTH0B04686g"
FT                   /old_locus_tag="KLTH-ORF15341"
FT                   /product="KLTH0B04686p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP2"
FT                   /protein_id="CAR21553.1"
FT                   /translation="MRYAFYEEHAPQLRSSRTTIVSNEDTWLSYKDAILDNINAPEKSQ
FT                   FENAYARELSRLESVGTWDATAPRPAHSLAPEAIIDTNFEFNTNSNGEKCCRVVQEGVS
FT                   "
     atgaggtacg cattttatga agagcatgca ccgcaactgc gctcttctcg aaccacaata        60
     gtttccaatg aagacacttg gttaagttat aaagatgcca ttctagacaa cataaacgcg       120
     ccagagaaat cacaatttga gaacgcatat gcgagagaac tttctcgact ggagagcgtt       180
     ggaacttggg atgcgactgc tccacgcccc gctcattcac tagcgcctga agcaatcatt       240
     gacaccaact tcgagttcaa caccaactcc aatggcgaaa aatgttgtcg agttgttcaa       300
     gagggagtaa gttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page