(data stored in ACNUC8465 zone)

EMBL: CU928166.PE191

CU928166.PE191       Location/Qualifiers
FT   CDS_pept        391353..392171
FT                   /locus_tag="KLTH0B04752g"
FT                   /old_locus_tag="KLTH-ORF15327"
FT                   /product="KLTH0B04752p"
FT                   /note="similar to uniprot|Q05775 Saccharomyces cerevisiae
FT                   YLR192C HCR1 Dual function protein involved in translation
FT                   initiation as a substoichiometric component of eukaryotic
FT                   translation initiation factor 3 (eIF3) and required for
FT                   processing of 20S pre-rRNA binds to eIF3 subunits Rpg1p and
FT                   Prt1p and 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21556"
FT                   /db_xref="GOA:C5DCP5"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP5"
FT                   /protein_id="CAR21556.1"
FT                   /translation="MSWDDEDFDLPSSAKNEPVLASWDDEFAETNDDDDAVLESWDAEP
FT                   AAASAKKPTAPAKKPAAKKDKKDAAASKPLLEIDTLDESTRRELLRKAEVDSDLNNAAD
FT                   LFGGLGVAEEHPRARALRKQQEEEALTRPAALTKDTPLDTHPLFQAESKKEYQELRKAL
FT                   AAAITPLNERSALNYSSGLAIDLIRDVANPMSTESIRQTIATLNVLMKDKERQERLARL
FT                   AKVKGGTATGGAGKKKAKATRANLGGAFKKDQEFDLETPAFDDFGEDDFM"
     atgtcctggg acgacgaaga ctttgactta ccctcttccg cgaaaaacga gcctgttctg        60
     gcgtcttggg acgacgagtt cgccgagacc aacgacgacg acgacgccgt gctggagtcg       120
     tgggacgccg agcccgcggc ggcgtcggcc aagaagccca ccgcgcccgc caagaagccc       180
     gcggccaaga aggacaagaa ggacgcggcc gctagcaagc cgctgctgga gatcgacacg       240
     ctcgacgaga gcactcgccg cgagctgctg cgcaaggccg aggtcgactc ggacctgaat       300
     aacgccgcag acctcttcgg cgggctcggc gtcgccgaag agcacccccg cgcgcgcgcg       360
     ctgcgcaagc agcaggagga agaggccctg actcgccccg ccgcgctcac caaagacacc       420
     ccgctcgaca cccacccact gttccaggcc gagtccaaaa aggagtacca ggagctgcgc       480
     aaggcgctcg ccgcggccat caccccgctc aacgagcgct ccgcgctcaa ctactcctct       540
     ggcctcgcca tcgacctgat tcgcgacgtc gccaacccca tgtccaccga gtccatccgc       600
     cagaccatcg ccacgctcaa cgttctcatg aaggacaagg agcgccagga gagactggcc       660
     cgtctggcca aggtcaaggg aggcaccgcc acaggcggtg ccggcaagaa gaaggccaag       720
     gctacgaggg ccaaccttgg cggagccttc aagaaggacc aggagttcga cctggaaacc       780
     ccagccttcg acgacttcgg cgaggacgac ttcatgtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page